SecReT4
Protein ID: 333983726
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2028
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2222373..2222819 [+]
Productconjugative transfer region lipoprotein
Component typeTfc15
UniProt IDG0A5A7
KEGG IDmmt:Metme_2028
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 148 a.a.     [Download]
>gi|333983726|ref|YP_004512936.1| unnamed protein product [Methylomonas methanica MC09]
MSWIKRFSVGLLAVSMTGLLSGCATGDKESILPQDGPTMKEVYQRHFSKPSGDAAESPLSVSIKPYRPKD
SSDQSPEQNQNPSSTPYTQSVGQAFQQQFPRLKNPTLIMYVFPHLSRDGRTPVPGYATGFSFYETIEFAL
PGEAEAGY
 
Nucleotide Sequence: 447 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2222373-2222819 Methylomonas methanica MC09 chromosome, complete genome
ATGAGCTGGATTAAGCGTTTTTCAGTCGGTTTACTGGCCGTGAGTATGACTGGATTACTCAGCGGCTGTG
CCACCGGCGACAAAGAAAGCATCCTGCCGCAGGACGGTCCGACGATGAAAGAAGTGTATCAACGGCATTT
TTCCAAACCTTCGGGCGATGCCGCTGAATCCCCGCTTTCGGTGTCGATCAAGCCTTACCGTCCCAAAGAC
TCAAGCGATCAATCACCGGAACAAAACCAAAATCCCAGTTCAACGCCCTATACCCAGTCGGTGGGGCAAG
CGTTTCAGCAGCAATTTCCCCGCCTAAAAAATCCCACGCTAATAATGTATGTGTTTCCGCATCTCAGCCG
CGATGGACGGACGCCGGTCCCGGGCTACGCCACCGGCTTCAGCTTTTATGAAACGATCGAGTTCGCCTTG
CCGGGCGAAGCGGAGGCGGGTTACTGA
 Primer design