SecReT4
Protein ID: 333983727
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2029
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2222819..2225629 [+]
Productconjugative transfer ATPase
Component typeTfc16
UniProt IDG0A5A8
KEGG IDmmt:Metme_2029
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 9.2e-46, Aligned region: 40..307
AAA_10 [PF12846], Evalue: 3e-34, Aligned region: 502..856
Protein Sequence: 936 a.a.     [Download]
>gi|333983727|ref|YP_004512937.1| unnamed protein product [Methylomonas methanica MC09]
MAWFRTLLTRQQRDFENCQRRATDKPPTERRIRQAYERPTAFTNLLPWLEYLPASQCFLLDDGYSVGALF
RIHTVGTDARSEAFLSDLRDKLQTALISLPEELENPWILQLFVQDEPHLTDLVDEIRRYAQPRARRSRFS
ESYFNVLEQHLAAISRSGGLFDDQLVTGGPWRGQRRMVRATLYRRRKVGQQAYAYHHISPAEELNDVADK
LTTALLTAGIKSSRCTGQDLYDWLFRWFNPKPVVTDGDTEALLKLAPYPGDSDMPFGHDFAERLMLGMPH
SDANHGLWWFDGLPHKVITVQALRNIPPIGLFGAERQVGEHRFALFDRMPENTVLSMTITLKAQDAVRNH
LAQVQRGAVGDYPEAKLAARDADQAQMEIARHNKLFPVQLAFFVRGDNEAALHQHINQVHSLLLANGLQP
IREADDVLALDSYLRNLPMAYCEVHDQREARRSRLMFSKHAANLAPVYGRSTGAGHPGFVFFNRGAEPLV
FDPLHSEDRKKNGHALIIGPTGAGKSATLVYLILQMMAIYRPRIFIIEAGNSFGLLGQYLHAQGVSLNQV
TLAPNVDVSLPPFSDALKLLDQRSKAVGSSAHNENTDWLSDELDNETVDGDEQKVDSEAGDDVDSEDAAR
DLLGEMEIASRIMITGGDSREDVRMTRADRLLIRNAILRAAKTVFDAGREQVLTQDVAQALRDLPGLSAQ
RQERSVEMADGMSLFCHGLAGHFFNRLGNRWPAVDVTIVDMGILAREGYEDQLTVAYIGLMNHIHDCVER
HQNDARPTLVITDEGHIITTNPLLSPYVIKIVKMWRKLGAWFWIATQNLDDFPQASKRMLNMLEWWLCLV
MPKEEVEQISRFKDLSTEQKAMLLATRKSPKQYTEGVVLTDERALLFRNVPPPLALALAMTEKDEKARRH
QIMQERGCTELEAVNVVAEELSRVRG
 
Nucleotide Sequence: 2811 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2222819-2225629 Methylomonas methanica MC09 chromosome, complete genome
ATGGCTTGGTTTAGAACATTACTGACCCGGCAACAGAGGGATTTCGAGAACTGTCAACGCCGGGCCACCG
ACAAACCGCCCACCGAACGGCGCATCCGCCAAGCCTACGAGCGGCCGACGGCGTTTACCAATTTGTTGCC
CTGGCTGGAATACCTGCCGGCTTCCCAATGTTTTTTGCTCGATGACGGTTACAGCGTCGGCGCGCTGTTT
CGGATTCACACCGTCGGAACAGATGCTCGCAGCGAGGCGTTTTTAAGCGATCTGCGCGACAAACTGCAAA
CGGCATTGATTTCGTTACCCGAAGAACTGGAGAATCCCTGGATCCTGCAGTTGTTCGTGCAGGATGAACC
CCATCTTACCGATCTGGTCGACGAGATTCGCCGCTATGCCCAACCGCGTGCCCGCCGTAGCCGCTTCAGC
GAAAGCTACTTTAACGTGTTGGAACAGCATCTGGCCGCCATCTCCCGCAGCGGCGGCTTGTTTGATGATC
AATTAGTCACCGGTGGCCCGTGGCGCGGGCAACGACGCATGGTTAGAGCGACCTTGTACCGGCGGCGAAA
AGTCGGGCAGCAGGCTTATGCGTATCATCACATCTCGCCGGCGGAAGAACTCAACGATGTCGCGGATAAA
TTGACGACGGCGTTATTGACCGCCGGTATCAAGTCCAGCCGCTGCACCGGGCAGGACCTCTATGACTGGT
TGTTCCGCTGGTTCAATCCCAAGCCTGTGGTGACGGATGGCGACACGGAGGCGCTGTTGAAACTGGCGCC
TTATCCCGGCGATAGCGACATGCCGTTCGGGCATGACTTTGCCGAGCGCTTGATGTTGGGTATGCCGCAT
TCCGATGCCAATCATGGGTTGTGGTGGTTTGACGGCCTACCGCATAAAGTCATCACCGTGCAGGCGCTTC
GCAATATCCCGCCAATCGGCTTATTCGGCGCCGAACGCCAGGTCGGAGAACATCGCTTTGCCCTGTTCGA
CCGCATGCCGGAAAACACTGTATTGAGCATGACCATCACCCTCAAAGCCCAGGATGCGGTGCGCAATCAC
TTGGCGCAGGTGCAACGCGGGGCGGTGGGTGATTATCCGGAAGCCAAGCTGGCGGCGCGGGATGCCGATC
AAGCGCAGATGGAAATTGCCCGGCACAATAAATTGTTTCCTGTGCAACTGGCTTTTTTTGTCAGAGGCGA
TAACGAAGCGGCATTGCATCAACACATCAATCAAGTGCATTCCTTGTTGCTGGCTAATGGTCTGCAACCG
ATTCGGGAAGCCGACGATGTGCTGGCGCTGGACAGTTATCTGCGTAATCTGCCAATGGCTTATTGTGAAG
TGCACGATCAACGCGAAGCTCGGCGCTCCAGGTTGATGTTTTCCAAACATGCCGCCAATCTGGCGCCGGT
TTATGGCCGCAGTACCGGCGCCGGCCATCCGGGCTTTGTGTTTTTCAATCGCGGCGCCGAACCGTTAGTG
TTCGATCCTTTGCATAGCGAGGACCGCAAAAAGAACGGCCATGCCTTGATCATTGGTCCTACCGGGGCCG
GCAAGTCGGCAACCTTGGTGTATCTGATTTTACAGATGATGGCCATTTATCGGCCGCGGATTTTTATCAT
TGAGGCCGGTAATTCCTTTGGGCTGTTGGGGCAGTATCTGCACGCGCAGGGGGTTAGTCTGAATCAAGTG
ACCCTGGCGCCGAATGTCGATGTCAGTTTGCCGCCGTTCAGTGATGCCTTAAAGCTGCTGGACCAGCGCT
CAAAAGCTGTTGGCAGTTCAGCTCATAATGAAAATACTGACTGGCTGAGCGATGAACTGGACAACGAAAC
CGTCGATGGCGACGAACAGAAAGTCGACAGCGAGGCAGGGGACGATGTAGACAGCGAAGATGCAGCGCGC
GATTTGCTGGGGGAAATGGAAATCGCCAGCCGCATCATGATTACCGGCGGCGATTCGCGCGAAGATGTGC
GCATGACTCGGGCCGACCGCTTGCTGATACGCAATGCCATTTTACGGGCGGCGAAAACGGTGTTCGACGC
CGGCCGCGAGCAGGTGTTGACGCAAGACGTCGCCCAAGCCTTGCGCGATTTGCCGGGCTTATCGGCACAA
CGGCAGGAGCGGTCGGTGGAAATGGCCGACGGCATGAGTTTGTTTTGTCACGGTTTGGCCGGGCATTTTT
TTAACCGGCTTGGCAATCGCTGGCCGGCGGTCGATGTGACCATCGTCGATATGGGTATTTTGGCTCGGGA
AGGTTACGAAGACCAGTTGACGGTGGCGTATATCGGCCTGATGAATCATATCCATGATTGTGTGGAACGG
CATCAAAACGATGCCCGGCCCACACTGGTGATTACCGATGAAGGCCATATCATCACGACGAATCCGTTGT
TATCGCCCTATGTCATCAAGATCGTCAAAATGTGGCGCAAGCTCGGCGCCTGGTTCTGGATCGCTACCCA
AAACCTGGACGATTTTCCGCAGGCCAGTAAACGCATGCTGAATATGCTGGAATGGTGGCTGTGTCTGGTG
ATGCCCAAGGAAGAGGTGGAACAGATTAGCCGCTTCAAGGACTTGAGCACCGAACAAAAGGCGATGTTGC
TGGCCACGCGCAAATCGCCCAAACAGTATACCGAAGGGGTAGTACTGACCGATGAACGGGCTTTGCTGTT
TCGGAACGTGCCGCCGCCGTTGGCCTTAGCATTAGCCATGACCGAAAAAGACGAAAAGGCGCGTCGGCAC
CAGATCATGCAGGAACGCGGCTGCACCGAACTGGAAGCGGTGAACGTGGTGGCCGAAGAACTCAGCCGGG
TGCGTGGGTGA
 Primer design