SecReT4
Protein ID: 333983728
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2030
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2225683..2226123 [+]
Productintegrating conjugative element protein
Component typeTfc24
UniProt IDG0A5A9
KEGG IDmmt:Metme_2030
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2.5e-27, Aligned region: 44..142
Protein Sequence: 146 a.a.     [Download]
>gi|333983728|ref|YP_004512938.1| unnamed protein product [Methylomonas methanica MC09]
MGLLVVCVFPTVAQEIPSAQDKPVIEVIVRDADRVIGLANLRQQGYDVKVYNLDAPKLVFTDLSQNLPAN
QEAAKRTLEQRMQQRGRQALQQQLIAAYQGLSVAIQYQVDRYPAVLFDRGQAVIYGVTDLQQVLDLYRQW
QSGLDQ
 
Nucleotide Sequence: 441 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2225683-2226123 Methylomonas methanica MC09 chromosome, complete genome
ATGGGGCTGCTGGTGGTTTGCGTTTTTCCGACAGTCGCCCAGGAAATCCCGAGTGCTCAGGATAAACCCG
TGATTGAAGTGATCGTCCGTGATGCGGATAGGGTGATAGGGCTGGCGAATCTGCGTCAACAAGGCTACGA
CGTCAAAGTCTACAATCTGGATGCACCCAAACTGGTGTTTACAGATTTAAGCCAAAACTTACCGGCCAAT
CAAGAAGCAGCCAAACGCACGCTGGAACAACGCATGCAACAGCGTGGCCGGCAAGCGTTGCAACAGCAGT
TGATAGCTGCGTATCAAGGTCTGTCCGTCGCCATTCAATACCAGGTCGATCGCTATCCGGCCGTGTTATT
CGATAGAGGGCAGGCGGTTATTTACGGCGTGACTGATTTGCAGCAGGTCTTGGATTTATATCGACAGTGG
CAAAGTGGTTTAGACCAATGA
 Primer design