SecReT4
Protein ID: 333983731
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2034
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2228352..2229713 [+]
Productintegrating conjugative element protein
Component typeTfc22
UniProt IDG0A5Z2
KEGG IDmmt:Metme_2034
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 453 a.a.     [Download]
>gi|333983731|ref|YP_004512941.1| unnamed protein product [Methylomonas methanica MC09]
MQTPIVCLVMLGCLANFNAPLCAAPFANSDNSDFYYEIGGARSISVPANTQVNTYAINGAFELGLGYSCG
NFDPTLGVANLLNGLQQTGNNLVNGAVGAVQAAIGGLPALVLQRIDPGLYDLFQNAVIRAEAVIALANKT
CEDYEQAIRQGQNPYADWSDLSKIIDWKVQMGKNGYGSAKNDVVQAKQNVQKANGQNGIPWIGGKKAGGV
KQAAIQVTHDSVTAGYNLTLNRQANDSSAPKKSKSTPRLAEVFADPGKASQWAVDVLGDVHIRTHDNHPV
ETIPGYGLLPKVEKDMQTIQKDLTDLVSGKTRTTLANLENVSSDAVLINGDVIAAIKTLKPSERAVAISK
LASEAAMTRTVEKAMLIRRLLLTATREPNLSATEATTAIQASIDQLDRDIADVLFERKIHNELASKTSAL
LLALQRQQTERGRAYQRPAGSDEAILQEEAIKP
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2228352-2229713 Methylomonas methanica MC09 chromosome, complete genome
ATGCAAACACCTATAGTCTGTTTAGTCATGCTAGGCTGCTTGGCGAACTTCAATGCGCCGCTTTGTGCGG
CCCCGTTTGCCAATAGCGACAACAGCGATTTTTACTATGAAATCGGCGGCGCCCGTTCGATCTCGGTGCC
GGCCAATACGCAAGTCAATACCTACGCCATCAACGGAGCGTTTGAACTCGGTTTGGGTTACAGCTGCGGA
AATTTCGATCCCACCCTGGGGGTGGCGAATCTACTGAATGGCTTGCAGCAAACCGGCAACAACTTAGTTA
ATGGTGCCGTCGGTGCAGTGCAGGCGGCTATCGGTGGTTTACCGGCTTTAGTATTGCAGCGCATCGATCC
GGGATTATATGACCTGTTTCAAAATGCGGTGATCAGGGCTGAGGCCGTTATCGCATTGGCCAATAAGACC
TGTGAAGACTATGAGCAGGCAATCCGTCAAGGTCAAAACCCGTATGCTGATTGGAGTGATCTTTCCAAGA
TTATCGACTGGAAAGTGCAGATGGGTAAAAACGGTTACGGCAGTGCCAAAAATGATGTCGTGCAAGCCAA
GCAAAACGTGCAAAAAGCCAACGGCCAGAACGGTATTCCGTGGATAGGCGGCAAAAAAGCCGGTGGAGTA
AAACAAGCGGCTATCCAGGTGACCCATGATAGCGTAACGGCCGGCTATAACCTGACTTTAAATCGTCAGG
CCAATGACAGCTCGGCACCTAAAAAGTCAAAAAGTACGCCGCGGCTGGCGGAAGTGTTCGCCGATCCGGG
CAAGGCTTCGCAATGGGCGGTTGATGTGCTAGGCGATGTGCATATCCGTACCCATGACAATCATCCGGTT
GAAACCATTCCTGGATACGGTCTTTTGCCCAAAGTCGAAAAAGACATGCAGACCATTCAAAAGGATTTAA
CCGATTTGGTGTCCGGCAAAACCCGAACGACGCTGGCTAATCTGGAAAACGTTTCCAGCGATGCCGTGTT
GATTAACGGCGATGTCATTGCCGCGATCAAAACCCTGAAACCTTCCGAACGAGCGGTAGCCATCAGCAAG
CTGGCTTCGGAGGCTGCAATGACCCGCACAGTGGAAAAAGCCATGTTGATTCGGCGCCTGTTGCTAACCG
CCACTCGCGAACCCAATCTCAGTGCCACCGAGGCGACGACGGCCATTCAAGCGTCCATTGACCAGCTAGA
TCGTGATATCGCTGATGTGTTGTTCGAACGGAAAATTCATAACGAATTGGCCTCGAAAACCTCTGCTTTG
TTATTGGCTTTACAACGGCAACAGACCGAACGCGGCCGGGCCTATCAGCGCCCAGCGGGTTCCGATGAAG
CGATTTTGCAAGAAGAGGCCATCAAGCCATGA
 Primer design