SecReT4
Protein ID: 333983733
T4SS name [ID]Tfc [751]
Gene symbol-
Locus tagMetme_2036
StrainMethylomonas methanica MC09
Repliconchromosome [GenBank: NC_015572] [Browse all T4SS(s) in this replicon]
Location [Strand]2230093..2231613 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDG0A5Z4
KEGG IDmmt:Metme_2036
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 4.8e-69, Aligned region: 8..484
Protein Sequence: 506 a.a.     [Download]
>gi|333983733|ref|YP_004512943.1| unnamed protein product [Methylomonas methanica MC09]
MSVSSYLEIYLTQFGWSLYGLLWDILVQTGLAYLPFIAMLLRNIAEPIKSQEAKDASSTSLRRIEIDLIS
MFTVIVLAVQPVLTIQINGLSVRKACANGQAITGGSTGTTYDSTFTQAALGGVSAKIPIWWYGVLAVTGG
IDDAAIVGIPCSADLRLTSFKISNARIKDPQLRQQTRLFFNDCYAPAMAAFLDNGQSLPNNHAPDDLDWL
GSTFMLNGAYQTLRASTNMPGFSYDKNRDLEYNPAVYLPKDGKPTCAQWWTGQGHVNNVGLRDALISQID
VSYLTDFKTTVAALSGKSKQDVEDIALKTLIAREEGYFNGLRDLNQYNDPSMANVGNSVAATLGSLVEAM
SFYPAMYMMKAAAPIIQAAILMLIYGLMPFYFLFSAYDISKVVFMSIIVFSVKFWTVLWAVAHWLDNHLL
AAIQPAWFQLQDAVSQNNMVVSMVVDFVVAGLFVVVPLFWSGVLGWAGYRVGSEMMSSLHRMRDNAGAAG
MAGGATAAKAGGRIIK
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|333981747|ref|NC_015572.1|:2230093-2231613 Methylomonas methanica MC09 chromosome, complete genome
ATGAGCGTATCCAGTTATTTGGAAATCTATCTGACCCAGTTTGGCTGGTCGCTGTATGGCCTGTTATGGG
ACATTCTGGTGCAAACCGGCTTGGCCTATTTACCATTTATTGCCATGTTGCTGCGTAATATCGCTGAGCC
GATCAAAAGCCAGGAAGCCAAGGATGCCTCCAGCACCTCGTTAAGACGGATCGAGATCGATTTGATTAGT
ATGTTTACGGTGATTGTGTTGGCGGTTCAGCCTGTCTTGACCATTCAAATCAACGGCTTGAGCGTCCGCA
AAGCCTGCGCGAATGGACAAGCCATCACAGGCGGCAGCACCGGGACTACTTATGACAGCACGTTTACTCA
GGCGGCTTTGGGTGGCGTCAGTGCCAAGATTCCGATCTGGTGGTACGGGGTATTGGCGGTGACCGGCGGT
ATCGATGATGCGGCGATTGTCGGAATACCCTGCAGTGCCGACCTGCGTCTGACGTCGTTTAAAATCAGCA
ACGCTCGCATCAAAGACCCGCAGTTGAGACAGCAGACACGCTTATTTTTTAACGATTGCTATGCGCCTGC
GATGGCGGCGTTTTTGGATAATGGTCAAAGCTTGCCGAACAATCACGCACCCGACGATCTGGACTGGTTG
GGTTCAACGTTTATGCTGAACGGGGCTTATCAAACCCTGCGCGCCAGTACCAATATGCCGGGATTCAGTT
ACGACAAAAACCGCGATCTGGAATACAACCCGGCTGTGTATCTGCCAAAGGACGGTAAGCCGACCTGCGC
CCAATGGTGGACCGGACAAGGGCATGTCAACAACGTCGGCTTGCGCGACGCCTTAATTAGCCAGATCGAC
GTCTCCTATCTGACCGATTTTAAAACGACGGTGGCAGCCTTATCCGGCAAGTCCAAGCAAGACGTCGAAG
ATATCGCTTTGAAAACGCTGATCGCACGAGAGGAAGGCTACTTTAACGGCTTGCGCGATCTCAATCAGTA
TAACGATCCCAGTATGGCCAATGTCGGCAACTCTGTTGCCGCGACACTGGGCAGCTTGGTCGAAGCGATG
TCCTTTTATCCGGCGATGTACATGATGAAAGCGGCCGCGCCCATCATCCAAGCGGCGATTCTGATGCTGA
TTTACGGCTTGATGCCGTTTTATTTTCTGTTTTCAGCGTACGACATCAGCAAGGTGGTGTTTATGTCCAT
TATCGTATTTTCGGTCAAATTCTGGACCGTGTTGTGGGCCGTCGCCCACTGGCTGGACAATCATTTGCTG
GCCGCCATCCAACCCGCCTGGTTTCAACTGCAGGATGCGGTAAGTCAAAACAATATGGTCGTATCGATGG
TGGTGGATTTTGTGGTTGCCGGATTGTTCGTGGTAGTGCCGCTGTTTTGGTCTGGCGTGCTGGGATGGGC
GGGGTATCGGGTTGGGAGTGAAATGATGAGCAGCCTACACAGGATGAGAGACAACGCCGGAGCCGCAGGA
ATGGCGGGGGGAGCCACAGCAGCAAAAGCGGGTGGAAGAATTATCAAATAG
 Primer design