SecReT4
Protein ID: 334139843
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2527
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]271480..272073 [+]
Productconjugal transfer protein TraF
Component typeTraF
UniProt IDF6IGF8
KEGG IDnpp:PP1Y_AT2527
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2e-44, Aligned region: 34..169
Protein Sequence: 197 a.a.     [Download]
>gi|334139843|ref|YP_004533042.1| conjugal transfer protein TraF [Novosphingobium sp. PP1Y]
MSRRRYVRATILWAGLFSAGFAAVAMLSPRPRIMWNASASAPVGLYRLEADTRPRLGELVAIVPPTATAR
MMADRHYLPIGVPLMKHVVALPGQWACRAGAVVSVDGNRVAIAKSHDRMGRPLPSWQGCHRVRPDELFLL
NPAPDSLDGRYFGALPAAGLIGTAHPILTRDAPDQSLRWRGFGASAASPTTNQEHRP
 
Nucleotide Sequence: 594 bp     [Download]
>gi|334139601|ref|NC_015580.1|:271480-272073 Novosphingobium sp. PP1Y chromosome, complete genome
ATGAGCCGCCGCCGCTATGTTCGCGCCACGATACTGTGGGCAGGCTTGTTCAGCGCCGGGTTCGCAGCAG
TCGCCATGCTGTCGCCGCGACCGCGAATAATGTGGAACGCGAGCGCCAGTGCGCCCGTCGGCCTCTATCG
CCTCGAGGCCGATACACGCCCAAGGCTCGGCGAACTGGTCGCCATTGTGCCGCCGACTGCGACCGCGCGG
ATGATGGCCGACCGCCACTATCTGCCAATTGGCGTGCCGCTCATGAAACATGTCGTGGCTCTGCCCGGGC
AATGGGCGTGCCGCGCCGGCGCTGTCGTCTCGGTGGACGGCAACCGTGTCGCCATAGCCAAATCGCACGA
CAGAATGGGTCGGCCTTTGCCAAGCTGGCAGGGCTGTCACCGCGTTCGGCCAGACGAATTGTTCCTGCTG
AACCCGGCGCCCGACAGTCTTGATGGGCGCTATTTCGGCGCTCTGCCGGCAGCCGGTCTTATCGGCACGG
CACACCCCATCCTTACCCGTGATGCACCTGACCAGTCCCTGCGCTGGCGAGGCTTTGGTGCATCCGCCGC
TTCCCCAACCACCAACCAGGAGCACAGGCCATGA
 Primer design