SecReT4
Protein ID: 334139846
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2572
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]275204..277264 [+]
Producttype IV secretion system protein VirD4
Component typeTraG
UniProt IDF6IGG1
KEGG IDnpp:PP1Y_AT2572
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.2e-103, Aligned region: 111..554
TraG-D_C [PF12696], Evalue: 3.2e-29, Aligned region: 401..521
TrwB_AAD_bind [PF10412], Evalue: 2e-26, Aligned region: 146..536
AAA_10 [PF12846], Evalue: 5.3e-09, Aligned region: 146..478
Protein Sequence: 686 a.a.     [Download]
>gi|334139846|ref|YP_004533045.1| type IV secretion system protein VirD4 [Novosphingobium sp. PP1Y]
MNATRILWGQVIAVISVTLLGIWSATQWTAHALAHQPELGQPWFWLGPWPIYPPYAFFWWWFAFDAYAPQ
IFQTGAFIAVSGVMAAIVIAIAMSVWRAREEKQSETYGSARWATDKEIRKAGLLKQDGVVIGSHKNRYLR
HNGPEHILCFAPTRSGKGVGLVIPSLLAWPGSCIVHDIKGENWDLTAGFRARHGRVLLFDPTNPASNPYN
PLLEVRKGDWEVRDAQNIADILIDPEGSLEKRTHWEKTSHSLLVGTILHVLYAEKDKSLAGVAGFLSDPR
RSIETTLHRMKTTPHLGKDGVHPVVAAAAQELLNKSDNERSGVLSTAMSFLGLYRDPVIAQVTGASDWRI
TDLVDSAAPVSLYLVIPPSDISRTKPLVRLMLNQIGRRLTEELKAKGRRQRVMFMLDEFPALGRLDFFES
ALAFVAGYGIKAFLIAQSLNQIEKAYGSNNAILDNCHVRVAFAANDDNTASRVSNALGTATQMRAMKNYA
GHRLSPWLGHIMVSRTETPRPLLTPGEVQQFSEHEEIVLVASTPPIRAEKAKYFLDPRFRARLLPAPTPK
PLHPKKRPKDDWSALAPIAAPLPVKPAQAEAKSSEQPPVDQPKPDVPSDADGAESENDTANSGIRREPEL
GEHEDVVPAPKPPVNEFDLDRDAPEDDAARAKREADRTMNRNARNASLDPDDGIDL
 
Nucleotide Sequence: 2061 bp     [Download]
>gi|334139601|ref|NC_015580.1|:275204-277264 Novosphingobium sp. PP1Y chromosome, complete genome
ATGAACGCCACCCGTATTCTTTGGGGTCAGGTCATCGCCGTCATCAGCGTTACTTTGCTTGGCATCTGGT
CTGCCACCCAATGGACGGCCCACGCCCTTGCGCATCAACCCGAGCTCGGCCAGCCCTGGTTCTGGCTTGG
ACCTTGGCCAATCTACCCGCCCTACGCCTTCTTCTGGTGGTGGTTTGCGTTTGACGCCTATGCACCACAG
ATCTTCCAGACCGGGGCATTCATCGCGGTCTCGGGTGTCATGGCCGCCATAGTTATCGCGATCGCCATGT
CGGTGTGGCGCGCGCGGGAGGAGAAGCAGTCAGAGACCTATGGTTCGGCTCGCTGGGCGACCGACAAGGA
AATCCGCAAGGCTGGCCTCCTGAAACAGGACGGCGTGGTGATCGGCTCGCACAAGAACCGGTATCTGCGG
CACAATGGCCCCGAGCATATTCTCTGCTTTGCGCCGACCCGTTCCGGCAAAGGCGTTGGTCTCGTCATCC
CGTCGCTGCTCGCCTGGCCGGGCAGTTGCATCGTCCACGATATCAAAGGCGAGAACTGGGATCTGACGGC
TGGCTTTCGCGCGCGGCATGGCCGCGTCCTGCTGTTCGATCCGACCAACCCCGCATCCAACCCCTACAAT
CCGCTGCTCGAAGTCCGGAAGGGCGATTGGGAGGTGCGTGACGCCCAGAACATCGCAGACATATTGATCG
ACCCCGAAGGGTCACTGGAAAAGCGCACGCATTGGGAGAAGACCAGCCACTCGCTACTCGTCGGCACCAT
CCTGCACGTCCTCTATGCCGAGAAGGACAAGTCGCTGGCCGGGGTCGCTGGCTTCCTTTCCGATCCGCGT
CGTTCGATAGAAACCACGCTGCACCGGATGAAGACGACCCCGCACCTCGGCAAAGATGGTGTTCACCCCG
TTGTGGCTGCCGCAGCACAGGAACTGCTGAACAAGTCTGACAATGAGAGGTCTGGCGTCCTGTCGACGGC
CATGTCGTTCCTCGGCCTCTACCGCGACCCTGTGATTGCGCAGGTCACCGGAGCCTCGGACTGGCGCATC
ACCGATCTTGTCGATTCAGCGGCACCTGTGTCGCTCTATCTGGTCATTCCTCCTTCCGATATCAGCCGGA
CCAAGCCGCTCGTCCGCCTGATGCTCAATCAGATCGGGCGCCGCTTGACCGAAGAGCTAAAGGCCAAGGG
TCGCCGGCAGCGCGTGATGTTCATGCTCGATGAATTCCCGGCTTTGGGGCGGCTAGACTTCTTCGAAAGC
GCACTGGCCTTTGTTGCAGGCTACGGGATCAAGGCATTCCTGATCGCGCAGTCGCTCAACCAGATTGAAA
AAGCCTATGGGTCAAACAACGCCATTCTCGACAACTGCCACGTCCGCGTCGCGTTCGCGGCCAATGATGA
CAATACCGCCAGCCGCGTTTCCAATGCGCTCGGCACCGCCACCCAGATGCGGGCGATGAAGAATTATGCC
GGACATCGCCTTTCGCCATGGCTCGGCCATATCATGGTCTCGCGTACTGAGACCCCAAGGCCATTGTTGA
CGCCTGGCGAAGTTCAGCAATTTTCGGAGCACGAGGAGATTGTGCTGGTGGCCAGCACGCCGCCGATCCG
CGCGGAAAAGGCAAAATACTTTCTCGACCCGAGGTTCCGCGCGCGCCTTCTACCGGCACCCACACCCAAA
CCGCTGCACCCGAAGAAACGGCCAAAGGACGACTGGTCTGCGCTCGCACCCATTGCGGCACCGCTGCCGG
TCAAACCAGCCCAGGCCGAAGCGAAAAGCTCCGAACAGCCGCCTGTTGATCAGCCAAAGCCGGATGTGCC
GTCAGATGCCGATGGGGCCGAATCCGAAAATGATACGGCAAACTCCGGGATCAGGCGAGAACCCGAACTG
GGGGAACATGAGGATGTCGTTCCCGCCCCCAAGCCACCGGTCAACGAGTTCGATCTTGATCGCGATGCGC
CCGAGGATGACGCAGCCAGGGCGAAACGGGAAGCTGATCGCACTATGAACCGCAATGCCCGCAATGCATC
GCTCGACCCCGATGACGGCATCGACCTGTGA
 Primer design