SecReT4
Protein ID: 334139856
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2673
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]283264..284247 [+]
Producttype IV secretion system protein VirB11
Component typeTrbB
UniProt IDF6IGH1
KEGG IDnpp:PP1Y_AT2673
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.6e-84, Aligned region: 24..292
FtsK_SpoIIIE [PF01580], Evalue: 1.5e-05, Aligned region: 147..177
Zeta_toxin [PF06414], Evalue: 2.7e-05, Aligned region: 147..214
TrwB_AAD_bind [PF10412], Evalue: 8.3e-05, Aligned region: 149..183
Protein Sequence: 327 a.a.     [Download]
>gi|334139856|ref|YP_004533055.1| type IV secretion system protein VirB11 [Novosphingobium sp. PP1Y]
MGAEPVRIEARSRGARMLRTAMGASIATWLADPKVIEIMLNPDGRLWVDRLGIGLSDSGERLTAADGERI
IRLVAHHVGAEVHGDAPRVSAELPESGERFEGLLPPVVAAPTFAIRKPAVAVFLLEDYVSAGIMCAAEAD
RLRSGVAQRLNILVAGGTGTGKTTLTNALLAEVAKTTDRVVLIEDTRELQCRAPNLVAMRTKDGVASLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSAIGALRRMEQLIQEAVVTVPRALIA
ETINLIAVLVRDGTGRRLAELARVDGLDPVTGDYRLISANQTQGDSL
 
Nucleotide Sequence: 984 bp     [Download]
>gi|334139601|ref|NC_015580.1|:283264-284247 Novosphingobium sp. PP1Y chromosome, complete genome
ATGGGCGCTGAGCCAGTCCGAATTGAAGCACGTTCACGCGGCGCACGCATGCTGCGCACGGCGATGGGCG
CATCGATCGCGACCTGGCTGGCTGACCCCAAGGTCATCGAGATCATGCTCAATCCTGATGGACGCCTTTG
GGTCGACCGGTTGGGCATCGGACTGTCCGACAGCGGTGAACGCCTGACCGCAGCCGATGGTGAACGCATC
ATCCGATTGGTTGCCCATCATGTGGGTGCCGAAGTTCACGGCGATGCACCGCGCGTGTCAGCGGAGCTGC
CGGAAAGCGGAGAACGGTTCGAAGGCCTCCTGCCACCGGTGGTGGCGGCTCCCACCTTTGCCATCCGCAA
GCCCGCCGTCGCGGTGTTTCTGCTCGAGGACTATGTCAGCGCAGGAATCATGTGCGCAGCTGAAGCCGAC
AGGCTTCGTTCGGGCGTTGCACAGCGGCTGAACATCCTTGTCGCCGGGGGCACTGGCACCGGCAAAACGA
CGCTCACGAACGCACTGCTCGCCGAGGTCGCCAAGACCACCGACCGGGTCGTTCTGATCGAAGATACCCG
CGAGCTTCAATGCCGCGCGCCAAACCTTGTGGCGATGCGGACCAAGGATGGCGTTGCCTCGCTATCCGAT
TTGGTCCGCTCGAGCCTTCGACTTCGCCCTGACCGGATTCCGATTGGCGAAGTGCGCGGCGCCGAGGCGC
TCGATCTCCTCAAGGCCTGGGGCACCGGCCACCCCGGAGGAATCGGGACGATCCACGCCGGAAGCGCGAT
TGGTGCCCTGCGGCGGATGGAGCAGCTGATCCAGGAAGCGGTCGTCACCGTCCCGCGCGCCCTGATCGCC
GAGACCATCAACCTCATTGCCGTGCTGGTGCGCGATGGCACCGGGCGGCGCCTCGCTGAACTGGCCCGCG
TCGACGGGCTGGACCCGGTCACCGGCGACTATCGCCTGATTTCCGCCAACCAAACCCAAGGAGACTCCCT
ATGA
 Primer design