SecReT4
Protein ID: 334139857
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2685
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]284244..284576 [+]
Producttype IV secretion system protein VirB2
Component typeTrbC
UniProt IDF6IGH2
KEGG IDnpp:PP1Y_AT2685
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9e-25, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|334139857|ref|YP_004533056.1| type IV secretion system protein VirB2 [Novosphingobium sp. PP1Y]
MIHALRRGTNRVALAATAAYVMVATATPAHAGGSSMPWEAPLQSILESIEGPVAKIVAVIIIIVTGLSLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|334139601|ref|NC_015580.1|:284244-284576 Novosphingobium sp. PP1Y chromosome, complete genome
ATGATCCATGCCCTCCGGCGCGGCACCAATCGTGTTGCGCTCGCAGCTACCGCTGCCTACGTGATGGTGG
CCACTGCCACTCCAGCGCATGCCGGCGGTTCGTCGATGCCGTGGGAAGCTCCGCTGCAGTCGATCCTCGA
GAGCATCGAGGGGCCAGTCGCCAAGATCGTGGCGGTGATCATCATCATCGTCACCGGCCTCAGCCTTGCC
TTTGGGGACACGTCGGGGGGCTTTCGCCGGCTGATCCAGATCGTGTTCGGCCTGTCGATTGCCTTTGCCG
CATCGAGCTTCTTCCTGAGCTTCTTCAGCTTCGGCGGCGGGGCGCTGATCTGA
 Primer design