SecReT4
Protein ID: 334139858
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2691
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]284842..287298 [+]
Producttype IV secretion system protein VirB4
Component typeTrbE
UniProt IDF6IGH3
KEGG IDnpp:PP1Y_AT2691
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.2e-35, Aligned region: 443..725
CagE_TrbE_VirB [PF03135], Evalue: 1.9e-11, Aligned region: 183..388
Protein Sequence: 818 a.a.     [Download]
>gi|334139858|ref|YP_004533057.1| type IV secretion system protein VirB4 [Novosphingobium sp. PP1Y]
MMSLQEYRTKSASLADFLPWVALVGPGVVLNKDGSFQRTARFRGPDLDSATPAELVAVTSRLNNALRRLG
SGWAVFVEAQRTAAQAYPQSRFPDPVSALVDRERREQFREEGAHFESGYYLTLLWMPPPEEAARAEGWLY
EGKASTGVDPKELVKSFADRTDRVLHLVEGFMPEAAWLDDAATLTYLHSTVSTRTQRVRVPETPVYLDAL
LADEPLTGGLEPMLGAHHLRTLTITGFPTATFPGLLDELNRQAFPYRWSTRAIMLDKTDATKLLSKIRRQ
WFAKRKSVAAILKEVMTNEQSVLMDSDASNKAADADMALQELGADHAGIAYVTATLTVWDRVPALAAEKL
RLVEKVIQGRDFTCTIEGMNALEAWLGSLPGHVYANVRQPPISTLNLAHLIPLSAVWAGAERDEHFGDAP
LLYGKTEGSTPFRLSLHVGDVGHSLIVGPTGAGKSVLLALMALQFRRYKGSQIFAFDFGGSIRAAALGMG
GDWQDLGGALHAEEGDSDAVALQPLARIDNAGERAWAAEWLAAMLAGEGMVIDPAAKEHLWSALTSLASA
PPAERTLTGLAVLLQSQELKQALAPYLIGGPWGRLLDAEQEHLGEASVQAFETEGLIGATSAAAVLAYLF
HRIEGRLDGSPTIIIIDEGWLVLDSPAFAAQLREWLKTLRKKNASVIFATQSLADIETSAIAPAIIESCP
TRIFLPNERAAEPQIARVYERFGLNDRQIEILSRATPKRDYYCQSRRGNRLFELGLGDVALAFSAASSKT
DQIRIAELVAAHGREGFAAAWLHNRSLAWAAELLPPPPPALTDKENRP
 
Nucleotide Sequence: 2457 bp     [Download]
>gi|334139601|ref|NC_015580.1|:284842-287298 Novosphingobium sp. PP1Y chromosome, complete genome
ATGATGTCGCTTCAGGAATATCGGACCAAATCCGCCAGTCTCGCAGACTTCCTCCCCTGGGTCGCACTGG
TGGGGCCGGGCGTGGTGCTCAACAAGGACGGATCGTTCCAGCGGACAGCGCGCTTTCGCGGTCCCGATCT
CGACAGTGCCACGCCCGCCGAACTCGTGGCCGTCACCTCCCGTCTCAACAACGCCCTGCGGCGGTTGGGT
TCAGGATGGGCGGTTTTCGTCGAAGCGCAGCGCACCGCGGCGCAAGCCTATCCGCAATCCCGCTTTCCCG
ATCCTGTCTCGGCACTGGTCGACAGGGAGCGCCGCGAACAGTTTCGTGAGGAAGGCGCGCACTTCGAAAG
CGGCTATTATCTGACGCTGCTGTGGATGCCGCCGCCCGAGGAAGCCGCGCGCGCCGAAGGCTGGCTCTAC
GAAGGCAAGGCGTCGACCGGGGTCGATCCCAAGGAACTCGTCAAATCCTTCGCCGATCGTACCGACCGCG
TGCTGCATCTGGTTGAGGGATTTATGCCCGAGGCAGCGTGGCTCGATGACGCTGCCACGCTGACCTATCT
CCACAGCACGGTATCGACCAGGACGCAGCGCGTTCGCGTGCCCGAAACGCCGGTCTATCTCGACGCGCTG
CTGGCCGATGAGCCGCTGACTGGCGGGCTTGAGCCCATGCTCGGCGCCCATCATTTGCGCACGCTCACGA
TCACCGGCTTTCCGACGGCGACCTTTCCCGGGCTGCTTGATGAGCTGAACCGGCAAGCCTTCCCGTACCG
CTGGTCGACGCGGGCAATCATGCTCGACAAGACCGATGCCACCAAGCTGCTCTCGAAAATTCGGCGGCAA
TGGTTCGCCAAGCGCAAATCGGTCGCCGCCATACTCAAGGAGGTGATGACTAACGAGCAGTCAGTGCTGA
TGGATTCGGACGCTTCGAACAAGGCGGCCGATGCCGACATGGCGCTGCAGGAGCTTGGCGCAGATCATGC
CGGCATTGCTTATGTCACTGCGACGCTCACGGTCTGGGACCGCGTCCCGGCGCTGGCGGCGGAGAAACTA
AGGCTGGTCGAAAAGGTCATCCAAGGCCGCGACTTCACCTGCACGATCGAAGGCATGAATGCGCTCGAGG
CATGGCTCGGATCGCTTCCCGGCCATGTCTACGCCAATGTCCGGCAGCCGCCCATTTCCACACTCAATCT
CGCCCACCTGATCCCCCTGTCAGCGGTATGGGCGGGAGCGGAACGGGACGAGCATTTCGGTGACGCCCCC
TTGCTTTACGGCAAGACCGAAGGCTCGACCCCGTTCCGCCTTTCTCTTCATGTCGGCGATGTCGGCCACA
GTCTGATCGTCGGCCCGACAGGGGCAGGCAAATCCGTGCTGCTGGCGCTGATGGCGCTGCAATTCCGGCG
CTACAAAGGCAGCCAGATCTTCGCCTTCGATTTTGGTGGATCGATCCGCGCTGCCGCGCTCGGCATGGGC
GGCGACTGGCAGGATCTCGGAGGCGCTCTGCATGCCGAGGAAGGCGACAGCGATGCTGTCGCCCTGCAGC
CGCTTGCAAGGATCGACAACGCCGGTGAACGCGCCTGGGCCGCCGAATGGCTGGCGGCGATGCTGGCCGG
GGAAGGCATGGTGATTGACCCTGCCGCCAAAGAGCATCTCTGGTCGGCCCTGACATCGCTTGCGTCCGCA
CCACCTGCCGAGCGCACACTCACCGGTCTCGCGGTCCTCCTGCAATCCCAGGAATTGAAGCAGGCACTAG
CCCCATATCTCATTGGCGGTCCATGGGGACGGCTGCTCGATGCCGAACAGGAACATCTGGGCGAGGCCTC
TGTGCAGGCTTTCGAAACCGAAGGTCTGATTGGCGCAACATCGGCCGCGGCTGTGCTCGCCTACCTGTTC
CACCGGATCGAAGGGCGGCTCGACGGCTCGCCGACCATAATCATCATCGATGAAGGCTGGCTCGTGCTCG
ACAGCCCGGCCTTCGCCGCGCAGCTGCGCGAATGGCTGAAGACGCTGCGCAAGAAGAATGCGAGCGTCAT
CTTCGCGACCCAGAGCCTTGCCGACATCGAGACGTCGGCCATCGCGCCTGCCATCATCGAAAGCTGCCCG
ACGCGCATCTTTCTGCCCAACGAGCGCGCGGCCGAACCGCAGATCGCACGGGTCTATGAGCGGTTCGGCC
TCAATGATCGCCAGATCGAAATCCTGAGCCGGGCTACCCCGAAACGCGATTATTACTGTCAATCGCGACG
CGGCAACCGGCTATTCGAGCTGGGCCTGGGCGATGTCGCACTCGCCTTCAGCGCCGCCTCTTCCAAAACC
GATCAGATCCGTATCGCCGAGCTTGTCGCAGCCCATGGCCGCGAAGGCTTTGCAGCGGCCTGGCTCCATA
ACCGCAGCCTCGCATGGGCGGCCGAGCTGCTTCCTCCCCCGCCGCCCGCACTAACGGACAAGGAAAACCG
CCCATGA
 Primer design