SecReT4
Protein ID: 334139859
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2717
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]287295..288014 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDF6IGH4
KEGG IDnpp:PP1Y_AT2717
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 239 a.a.     [Download]
>gi|334139859|ref|YP_004533058.1| conjugal transfer protein TrbJ [Novosphingobium sp. PP1Y]
MKIPVLRRALMATAIATSLVSGTMIAAPAQAQFGGIVYDPSNYAQNVLTAARTLQQINNQIQQIQNQATS
LINEARNLTSLPVSTIQTLQQQVDQTRQLLNQAQRIAYDVTDVQQVFNGRYKGAALTGGQAQMVANANAR
WQDSVGAFEDAMKVQAGIVGNLGATRSSITTLVGASQSATGALQAAQAGNQLLALQTQQLADLTAAIAAQ
GRAQSIEAARNAATEAEGRERFRRFRTRN
 
Nucleotide Sequence: 720 bp     [Download]
>gi|334139601|ref|NC_015580.1|:287295-288014 Novosphingobium sp. PP1Y chromosome, complete genome
ATGAAAATACCCGTCCTCCGCCGCGCTCTCATGGCGACGGCGATCGCCACTTCGCTGGTTTCAGGCACCA
TGATCGCCGCGCCAGCGCAGGCCCAGTTTGGCGGGATCGTCTATGATCCCAGCAACTACGCGCAGAACGT
GCTGACCGCCGCCCGGACGCTGCAGCAGATCAACAACCAGATCCAGCAGATCCAGAACCAGGCGACCAGC
CTCATCAACGAGGCCCGCAATCTTACCAGTCTGCCGGTCTCGACGATCCAGACGCTTCAGCAACAGGTCG
ACCAGACCCGCCAGTTGCTGAACCAGGCCCAGCGCATCGCCTATGACGTGACCGACGTGCAGCAGGTGTT
CAACGGCCGTTACAAGGGGGCGGCACTGACCGGCGGGCAAGCCCAGATGGTCGCTAACGCCAATGCGCGC
TGGCAGGACAGCGTCGGCGCCTTCGAAGACGCAATGAAGGTGCAGGCGGGGATCGTCGGCAATCTGGGTG
CGACCCGCAGCTCGATCACGACACTGGTCGGCGCTAGCCAATCAGCGACCGGGGCTTTGCAGGCGGCACA
GGCCGGCAATCAGCTACTGGCTTTGCAAACCCAGCAGCTGGCCGATCTGACTGCCGCCATTGCGGCGCAG
GGCCGCGCACAGTCGATCGAGGCCGCGCGCAATGCCGCGACCGAGGCCGAGGGCCGCGAGCGTTTCCGCC
GCTTCCGGACCCGGAACTGA
 Primer design