SecReT4
Protein ID: 334139860
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2728
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]288267..289547 [+]
Producttype IV secretion system protein TrbL
Component typeTrbL
UniProt IDF6IGH5
KEGG IDnpp:PP1Y_AT2728
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.6e-47, Aligned region: 37..262
Protein Sequence: 426 a.a.     [Download]
>gi|334139860|ref|YP_004533059.1| type IV secretion system protein TrbL [Novosphingobium sp. PP1Y]
MNDTGVIDQFLTVFTQYIDSGFGLLGGEVGFLSTTLIVIDVTIAALFWAWGTDEDVLQRLIKKTLYIGTF
AFIIGNFSNLAGIMLQSFAGLGLQASGSGMAIGDFMRPGVVAATGLDAGQPLLDATADLVGPVGLFTNFV
QILILLISWLIVVIAFFVLAIQVFVTIIEFKLVTLAGFVLLPFAFFGRTAFMAERVLGHIISSGIKVLVL
AVITGIGTTLFTQFINAGLGVEPDIQQVMAIALAALTLLGLGIFGPSIANGIVSGGPQLGAGAAAGTAIA
AGATIAGGIAGAKLAAGAAGSAMAGAATGGARAAGGASGAYAAGAAGKTGRAAAASGLANVAKSAASSAA
SPLRRAADSLKANYAAGKAGTPANAAATGAADGPPAWATAMKRRQAMTQGANMASHTLKGGDSHGGGSGP
DISDKS
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|334139601|ref|NC_015580.1|:288267-289547 Novosphingobium sp. PP1Y chromosome, complete genome
ATGAATGATACCGGCGTCATCGACCAGTTTCTGACGGTCTTCACCCAATACATCGACAGCGGCTTCGGTC
TGCTCGGCGGTGAGGTCGGCTTCCTGTCGACCACCCTCATCGTCATCGACGTGACCATAGCTGCCTTGTT
CTGGGCCTGGGGCACCGACGAGGATGTGCTGCAGCGCCTGATCAAGAAGACGCTCTACATCGGCACTTTC
GCCTTCATCATCGGCAACTTCTCGAATCTCGCTGGCATTATGCTCCAGAGCTTTGCCGGGCTTGGCCTGC
AGGCCAGTGGCAGCGGCATGGCGATCGGCGATTTCATGCGCCCCGGCGTTGTGGCCGCAACCGGTCTTGA
TGCCGGACAACCGCTGCTCGACGCCACCGCCGATCTTGTCGGGCCGGTGGGTCTGTTCACCAATTTCGTG
CAGATCCTGATCTTGCTGATCTCCTGGCTGATCGTTGTCATCGCCTTCTTCGTGCTGGCGATCCAGGTCT
TCGTCACCATCATCGAGTTCAAACTGGTGACGCTCGCCGGCTTTGTGCTGCTGCCGTTCGCCTTTTTCGG
GCGCACCGCCTTCATGGCCGAGCGCGTCCTTGGCCATATCATTTCCTCCGGCATCAAGGTCCTGGTGCTT
GCCGTCATCACCGGCATTGGCACGACACTCTTCACGCAGTTCATCAATGCCGGACTCGGGGTCGAACCCG
ACATCCAGCAGGTCATGGCGATTGCGCTCGCAGCGCTGACGTTGCTCGGCCTTGGTATCTTTGGTCCCAG
CATCGCCAACGGCATTGTGTCGGGCGGACCGCAGCTTGGCGCAGGGGCGGCGGCAGGCACTGCGATCGCT
GCCGGCGCGACGATTGCGGGCGGCATCGCAGGTGCCAAGCTCGCCGCAGGTGCCGCCGGCTCGGCCATGG
CGGGCGCGGCCACGGGCGGTGCTCGCGCGGCAGGCGGCGCATCGGGTGCCTATGCAGCCGGAGCCGCTGG
CAAAACCGGACGGGCTGCGGCTGCTTCGGGTCTCGCCAATGTCGCAAAATCAGCCGCAAGCAGCGCGGCG
TCACCACTTCGCCGGGCCGCGGACAGCCTCAAAGCGAACTATGCCGCTGGCAAGGCGGGAACGCCCGCCA
ATGCGGCAGCGACCGGCGCCGCCGATGGCCCTCCTGCATGGGCCACCGCGATGAAACGGCGTCAGGCGAT
GACGCAGGGTGCCAACATGGCCTCGCATACCCTCAAGGGCGGCGACAGCCACGGCGGCGGCTCTGGCCCC
GACATCTCCGACAAAAGCTGA
 Primer design