SecReT4
Protein ID: 334139861
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2739
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]289569..290252 [+]
Producttype IV secretion system protein VirB5
Component typeTrbF
UniProt IDF6IGH6
KEGG IDnpp:PP1Y_AT2739
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.3e-59, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|334139861|ref|YP_004533060.1| type IV secretion system protein VirB5 [Novosphingobium sp. PP1Y]
MFRRPSIRYGTSPEPVTPYQRAAQVWDDRIGSARVQAKNWRLAFFGCLALSGGLAGGLVWQSARGTITPW
VVEVDKLGQAQAIAPADVDYRPTDPQMAFHLARFIEQVRAIPADPIVLRQDWLRAYDFTTDRGAQALNDY
ARGNDPFAQVGKVQVAVDVSSVVRASNDSFRVGWTERRYQDGALIETSRWSAILTTVVQPPRTPDALRKN
PLGLFINAINWSKELSQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|334139601|ref|NC_015580.1|:289569-290252 Novosphingobium sp. PP1Y chromosome, complete genome
ATGTTTCGACGCCCCTCTATCCGCTACGGGACCAGTCCAGAGCCCGTCACACCCTATCAACGCGCCGCAC
AGGTCTGGGACGACCGCATCGGTTCAGCACGGGTGCAGGCGAAAAACTGGCGGCTTGCCTTCTTCGGTTG
CCTTGCGCTTTCGGGAGGGCTGGCAGGCGGTCTCGTCTGGCAATCGGCGCGCGGCACGATCACGCCCTGG
GTGGTCGAGGTCGACAAGCTCGGACAAGCGCAGGCCATCGCCCCTGCCGATGTCGATTATCGCCCGACCG
ACCCGCAGATGGCGTTCCACCTTGCTCGCTTCATCGAACAGGTGCGCGCCATTCCCGCCGATCCGATCGT
GCTGCGGCAAGACTGGCTCAGGGCTTACGACTTCACCACCGACCGCGGCGCGCAGGCGCTCAACGACTAT
GCGCGGGGCAACGATCCCTTCGCCCAAGTCGGCAAGGTGCAGGTCGCAGTCGATGTGTCGAGCGTCGTTC
GTGCGTCGAACGACAGCTTCCGCGTTGGCTGGACCGAGCGGCGTTACCAGGATGGCGCACTTATCGAGAC
TTCGCGGTGGTCAGCGATCCTGACCACCGTTGTGCAGCCACCACGCACCCCCGATGCCCTGCGCAAGAAT
CCGCTCGGCCTGTTCATCAACGCCATCAACTGGTCAAAGGAGCTTAGCCAATGA
 Primer design