SecReT4
Protein ID: 334139862
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2745
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]290327..291166 [+]
Producttype IV secretion system protein VirB9
Component typeTrbG
UniProt IDF6IGH7
KEGG IDnpp:PP1Y_AT2745
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.5e-69, Aligned region: 47..271
Protein Sequence: 279 a.a.     [Download]
>gi|334139862|ref|YP_004533061.1| type IV secretion system protein VirB9 [Novosphingobium sp. PP1Y]
MAREQRAQPQAIPATSAQTVEPADPRTRVGRANAAARVEPERTSYFNAIQQYAYTDGALFQIYSAPGQIT
DIMLQEGEELVGPGPVASGDTVRWIIGDTVSGSGSSRRVHILVKPTRADIRTNLIINTNRRTYHLELSAT
NSTYMAAVSWTYPQDALIALRTAEAERERTAPVAAGINFSSLNFRYRIAGDRPGWRPVRVFDDGRQVFIE
FPGDIASGDMPPLFVIGADQAAELVNYRVQGRYMVVDRLFEHAELRLGAGNSAKQVRIERERARRRSRS
 
Nucleotide Sequence: 840 bp     [Download]
>gi|334139601|ref|NC_015580.1|:290327-291166 Novosphingobium sp. PP1Y chromosome, complete genome
ATGGCGCGCGAACAGCGCGCTCAGCCGCAAGCAATTCCTGCTACATCGGCGCAGACTGTTGAGCCTGCCG
ACCCGCGCACCCGTGTCGGTAGAGCCAACGCCGCAGCGCGGGTCGAACCGGAGCGCACCAGCTATTTCAA
TGCCATCCAGCAATATGCCTATACCGATGGAGCCCTTTTTCAGATTTACAGCGCACCGGGGCAGATTACC
GACATCATGCTGCAGGAAGGCGAAGAACTCGTTGGACCGGGGCCGGTCGCATCGGGCGATACGGTCCGCT
GGATCATCGGCGACACGGTAAGCGGGAGCGGATCATCGCGCCGCGTTCACATCCTCGTCAAGCCGACGCG
GGCCGACATTCGCACCAACCTCATCATCAATACCAATCGGCGCACCTATCATCTTGAACTCAGTGCGACG
AACTCGACCTATATGGCCGCAGTCTCCTGGACCTATCCGCAGGACGCCCTGATCGCCCTGCGAACGGCTG
AGGCCGAGCGTGAACGCACAGCTCCGGTGGCGGCGGGTATCAATTTCTCAAGCCTGAACTTTCGCTACCG
CATTGCGGGCGATCGTCCCGGATGGCGGCCAGTACGGGTGTTCGATGATGGCCGGCAGGTGTTCATCGAG
TTTCCGGGCGACATTGCGAGCGGCGATATGCCGCCGCTGTTCGTGATCGGCGCGGACCAGGCAGCTGAGC
TGGTGAACTACCGTGTGCAAGGCCGGTATATGGTTGTCGACCGGCTGTTTGAGCATGCGGAATTGCGGCT
TGGCGCAGGCAACAGCGCCAAGCAGGTTCGCATTGAGCGTGAACGCGCACGCCGCCGGAGCCGCTCATGA
 Primer design