SecReT4
Protein ID: 334139863
T4SS name [ID]Trb [288]
Gene symbol-
Locus tagPP1Y_AT2755
StrainNovosphingobium sp. PP1Y
Repliconchromosome [GenBank: NC_015580] [Browse all T4SS(s) in this replicon]
Location [Strand]291163..292488 [+]
Producttype IV secretion system protein VirB10
Component typeTrbI
UniProt IDF6IGH8
KEGG IDnpp:PP1Y_AT2755
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.2e-61, Aligned region: 254..432
Protein Sequence: 441 a.a.     [Download]
>gi|334139863|ref|YP_004533062.1| type IV secretion system protein VirB10 [Novosphingobium sp. PP1Y]
MSTRPQDHSVPPVTNRIVEAEVETDVETDVDADAEGDEPDDESPVAAASPDGFRLGGEPPRVMRLSRKAL
ATLGLLASVGIGGALIYALQPKNHAPAENLYDTNSRNRADSVNGAPANYGDVPKLGPALPGDLGGPIVAA
QRGGQNVPIPPIGAAPAPGQPDPRIAAAEQARERAAQERDSARTSRLFLAGETGTTDNRSATAVGPAPSA
SILGADPAQPSAPTATSSRRAFLGQRGNRSTESPERIMRLASPYVVQAGSVIPAALITGIRSDLPGQITA
QVTQNVYDSPTGRILLIPQGSRLIGEYDSDVAAGQNRVLLAWDRLILPGGHSILLDRLPGADAAGMAGLE
DQTNYHWGNMLKAALISTLLGAGTELISNGDSDLIRALRFGTQDTISQTGRQVVQRQLNVPPTLTVRPGF
SLRIIVTRDLVLEPMPAGGAR
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|334139601|ref|NC_015580.1|:291163-292488 Novosphingobium sp. PP1Y chromosome, complete genome
ATGAGCACGCGACCGCAGGATCATAGTGTGCCACCGGTCACCAACCGGATTGTCGAGGCTGAAGTCGAGA
CCGACGTTGAAACTGACGTTGATGCCGATGCCGAAGGCGACGAGCCTGACGACGAGAGCCCGGTTGCAGC
GGCCAGTCCGGACGGGTTTCGCCTTGGCGGGGAACCGCCGCGCGTCATGCGACTGTCGCGCAAGGCACTG
GCGACTCTTGGCCTCCTCGCCAGCGTCGGGATTGGCGGTGCGCTAATCTACGCACTGCAACCCAAGAACC
ACGCGCCAGCCGAGAATCTCTACGATACGAACAGCCGCAACCGCGCGGACTCGGTCAACGGTGCGCCTGC
CAACTACGGCGACGTGCCCAAGTTGGGGCCTGCACTGCCCGGCGACCTCGGCGGTCCTATTGTTGCCGCA
CAGCGTGGCGGACAGAATGTCCCGATCCCGCCAATTGGTGCCGCTCCGGCCCCAGGACAGCCCGATCCGC
GGATTGCAGCCGCCGAACAAGCGCGCGAGCGCGCCGCGCAGGAGCGTGACAGCGCCCGGACCAGTCGCCT
GTTTCTTGCCGGAGAGACCGGAACGACCGACAATCGGTCTGCAACCGCAGTAGGGCCAGCGCCATCAGCT
TCGATACTAGGTGCGGATCCAGCTCAACCGTCTGCACCAACAGCCACGTCAAGCCGCCGCGCATTTCTCG
GACAGCGCGGCAACCGCAGCACGGAAAGCCCTGAGCGCATCATGCGCCTTGCATCGCCTTACGTTGTGCA
GGCCGGAAGCGTGATACCGGCAGCGCTCATAACCGGCATCCGGTCCGACCTTCCAGGTCAGATCACAGCG
CAGGTTACGCAGAACGTCTATGACAGCCCCACTGGCCGGATCCTCCTGATCCCCCAAGGCTCAAGGCTGA
TCGGTGAATATGACAGCGACGTAGCCGCCGGACAGAACCGCGTGCTGCTGGCTTGGGACCGCCTCATCCT
TCCCGGAGGTCATTCGATCCTGCTTGATCGCCTGCCCGGCGCTGATGCTGCCGGTATGGCCGGCCTTGAA
GACCAGACCAACTATCATTGGGGCAACATGCTCAAGGCCGCGCTCATTTCGACATTGCTGGGCGCTGGCA
CAGAGCTCATCTCGAACGGTGATAGCGATCTCATTCGGGCGCTGCGTTTCGGCACGCAGGACACCATAAG
CCAGACTGGCAGGCAGGTTGTGCAGCGGCAATTGAACGTGCCGCCGACCCTGACCGTGCGGCCCGGATTT
TCGCTGCGCATCATCGTCACGCGTGATCTTGTGCTCGAACCGATGCCTGCAGGAGGAGCGCGATGA
 Primer design