SecReT4
Protein ID: 334143074
T4SS name [ID]VirB [27]
Gene symbol-
Locus tagPP1Y_Spl287
StrainNovosphingobium sp. PP1Y
Repliconplasmid Spl [GenBank: NC_015582] [Browse all T4SS(s) in this replicon]
Location [Strand]27905..29638 [-]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDF6IBV9
KEGG IDnpp:PP1Y_Spl287
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-99, Aligned region: 51..500
TraG-D_C [PF12696], Evalue: 1.8e-26, Aligned region: 347..466
TrwB_AAD_bind [PF10412], Evalue: 9.9e-26, Aligned region: 263..477
AAA_10 [PF12846], Evalue: 2.1e-06, Aligned region: 106..426
Protein Sequence: 577 a.a.     [Download]
>gi|334143074|ref|YP_004537950.1| type IV secretion system protein VirD4 [Novosphingobium sp. PP1Y]
MKVPGALWSMKSMPIVWQPFLLGFAISFALCLVGVFASMFSAQKLHGEARWARFGEVKDAGLLASAGIIL
GRFNARFLRFGGTEHVMLEAPTRAGKGVGVVIPNLLSWPDSVVVLDVKQENWDLTSGYRAKELRQKTLLF
NPLDGEGRTCRYNPLGHIDRRDPVEIINELQKIGAMLFPLPLTGDNFWAESARTAFLGVSAYVAATVDDG
EDALPFTIGEVYRQFAAGDARRRFPKIIKQREQAGKPLSGACISALRDWISSSDNTFTSIRQSVTAKINL
WLNPYVDAATAESDFDLRQFRDKRISLYLGVSPDDLERVAPIYNLLFQQLIDLNVRELPSSDRHNVRLLL
LLDEFTRLGRASVIASGFSYVAGYGIRLLPVIQNFSQLDHIYGDKVAKEISANCGVQIVMRPKEINDAKN
VSERLGTYTFRAKSRSFGAWGRGGGSVSESDQRRALLLPQELLLLPEKDLIVLRSGIPPVYGRKIRYYQE
KDMLALTKVPAPAMPTIRPDPSVPARSLRVITAAEASGESDAVIPGASARPLNMPVVKALQATANHAPRQ
TAHMLFKDLFSVMIPTA
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|334143044|ref|NC_015582.1|:c29638-27905 Novosphingobium sp. PP1Y plasmid Spl, complete sequence
ATGAAAGTGCCGGGCGCGCTCTGGTCGATGAAATCCATGCCGATCGTCTGGCAACCGTTTCTTCTGGGCT
TCGCGATCAGCTTTGCCTTGTGCCTGGTCGGCGTCTTCGCCTCGATGTTCTCGGCTCAAAAGCTGCACGG
CGAGGCACGCTGGGCGCGCTTTGGCGAGGTGAAGGATGCTGGGCTTCTCGCAAGCGCCGGCATCATCCTT
GGCCGTTTCAATGCCAGGTTTCTGCGCTTCGGCGGGACCGAGCATGTCATGCTCGAAGCCCCAACCCGGG
CCGGCAAGGGCGTGGGCGTCGTGATCCCGAACCTGCTGTCCTGGCCCGATTCCGTCGTGGTCCTCGATGT
GAAGCAGGAGAACTGGGACCTGACCTCAGGCTACCGCGCCAAGGAGCTTCGCCAGAAGACGCTCCTGTTC
AACCCGCTCGACGGGGAAGGAAGGACATGCCGCTACAATCCGCTCGGCCATATCGACCGCCGCGATCCCG
TCGAAATCATCAACGAGTTGCAGAAGATCGGAGCCATGCTGTTCCCGCTCCCCCTGACCGGCGACAATTT
TTGGGCCGAAAGCGCGCGCACGGCCTTTCTCGGCGTCTCAGCTTATGTCGCGGCCACGGTCGATGATGGC
GAGGACGCCCTGCCCTTCACGATCGGCGAGGTCTACCGCCAGTTCGCCGCTGGCGATGCCAGGCGCCGCT
TCCCGAAGATCATCAAGCAGCGCGAACAGGCCGGAAAGCCTCTCTCGGGCGCGTGCATTTCTGCGCTGCG
CGACTGGATTTCTTCGTCGGACAACACCTTCACGTCCATTCGCCAGTCCGTGACGGCCAAGATCAACCTT
TGGCTCAACCCTTATGTCGACGCGGCAACGGCCGAGAGCGACTTCGATCTGCGCCAGTTTCGCGACAAGC
GGATCTCGCTCTACCTCGGCGTTTCGCCCGACGACCTCGAGCGGGTCGCGCCGATCTACAACCTGCTCTT
CCAACAGCTCATCGACCTCAACGTGCGCGAGCTGCCCTCATCCGACCGGCACAACGTGCGCCTACTCCTC
CTGCTCGACGAGTTCACCCGCCTCGGCCGGGCCTCGGTTATCGCCAGCGGCTTCAGCTATGTGGCGGGCT
ACGGCATCCGCCTCCTCCCCGTGATCCAGAACTTCTCCCAGCTCGATCACATCTACGGCGATAAGGTGGC
CAAGGAGATCTCCGCGAACTGCGGCGTGCAGATCGTCATGCGACCCAAGGAGATCAACGACGCCAAGAAC
GTCTCGGAGCGCCTGGGCACCTACACCTTTCGCGCCAAATCCCGTTCGTTCGGCGCCTGGGGCCGCGGCG
GCGGTTCGGTGTCAGAATCCGATCAGCGCCGTGCGCTCCTGCTCCCGCAAGAGCTTCTCTTGCTGCCCGA
AAAGGACCTGATCGTCCTGCGCTCGGGCATCCCGCCCGTCTACGGCAGGAAGATCCGGTACTATCAGGAG
AAGGACATGCTCGCGCTGACGAAGGTGCCGGCTCCGGCGATGCCGACGATCCGGCCCGACCCTTCCGTTC
CGGCGCGAAGCCTTCGCGTCATCACGGCTGCGGAGGCGAGTGGGGAAAGCGACGCGGTAATACCCGGAGC
CAGCGCCAGGCCTCTAAACATGCCGGTGGTCAAAGCGCTTCAGGCGACAGCCAATCACGCCCCCCGGCAG
ACGGCGCACATGTTGTTCAAGGACCTATTTTCCGTGATGATCCCAACAGCCTGA
 Primer design