SecReT4
Protein ID: 334143075
T4SS name [ID]VirB [27]
Gene symbol-
Locus tagPP1Y_Spl305
StrainNovosphingobium sp. PP1Y
Repliconplasmid Spl [GenBank: NC_015582] [Browse all T4SS(s) in this replicon]
Location [Strand]29804..30820 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDF6IBW0
KEGG IDnpp:PP1Y_Spl305
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.9e-78, Aligned region: 12..312
AAA_29 [PF13555], Evalue: 7.4e-05, Aligned region: 148..183
FtsK_SpoIIIE [PF01580], Evalue: 9.1e-05, Aligned region: 155..182
Protein Sequence: 338 a.a.     [Download]
>gi|334143075|ref|YP_004537951.1| type IV secretion system protein VirB11 [Novosphingobium sp. PP1Y]
MAHVSTIYQHNAAPLQPLLDREDVTELVINEPGVIGVETRKGWEWHEAPALDHASLMTLARLIAGLTKQD
ISEDYPICSSVLPGGERAQVVIPPAIERGFVSITIRKASNTAMDLGDLDRSGLFSEVKAHGAANEVDDAL
LAYRAAGDWNGFFKLAVEARKNILISGATGSGKTTFSKALIKLIPDFERVLTIEDTRELVVPQRNRVHMM
YSKDGHGLQKAGAKELLESALRMRPDRILLQELRDGTAFFYLRNVNSGHPGSITTVHANTAEGALEQLTL
LVKESEGGNDLDRHDIRALLRSLVDIVVQMHRLPPSDGRPARYRMTEVWFDPAGKPHD
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|334143044|ref|NC_015582.1|:c30820-29804 Novosphingobium sp. PP1Y plasmid Spl, complete sequence
ATGGCACACGTCTCTACGATCTACCAGCACAATGCAGCCCCGCTGCAACCGCTCCTCGATCGCGAGGACG
TGACCGAACTGGTCATCAACGAGCCGGGCGTGATCGGCGTCGAAACCCGCAAGGGGTGGGAGTGGCATGA
AGCGCCCGCGCTCGATCACGCCAGCCTCATGACGCTGGCCCGCCTCATTGCGGGCCTGACCAAGCAGGAC
ATCAGCGAGGACTACCCCATCTGCTCCTCGGTCCTGCCGGGCGGCGAGCGCGCCCAGGTCGTGATCCCGC
CTGCCATCGAGCGCGGCTTCGTCTCGATCACGATCCGCAAGGCCTCGAACACGGCGATGGATCTTGGCGA
CCTCGACCGCTCAGGGCTCTTCAGCGAAGTGAAGGCACACGGTGCCGCCAACGAGGTCGATGACGCCTTG
CTGGCCTACCGGGCCGCAGGCGACTGGAACGGCTTCTTCAAGCTCGCCGTCGAGGCGCGCAAGAACATCC
TGATTTCCGGGGCGACCGGCTCGGGAAAGACCACTTTCTCCAAAGCCCTCATCAAATTGATCCCTGACTT
CGAGCGAGTGCTGACGATCGAGGATACCCGCGAACTGGTGGTCCCCCAGCGCAACCGGGTTCACATGATG
TATTCCAAGGATGGGCACGGTCTGCAAAAGGCGGGCGCGAAGGAATTGCTGGAATCGGCGCTGCGCATGC
GCCCCGACCGCATCCTTCTCCAGGAGCTGCGCGACGGCACCGCCTTCTTCTACCTGCGCAACGTCAACAG
CGGGCATCCCGGCTCGATCACGACCGTCCACGCCAACACTGCCGAAGGCGCGCTCGAGCAGCTCACCTTG
CTCGTCAAGGAATCCGAAGGCGGCAACGACCTCGACCGCCACGACATTCGCGCGCTGCTGCGGTCGCTCG
TCGACATCGTGGTGCAGATGCACCGCCTTCCGCCCAGCGACGGCCGACCTGCCCGCTACCGGATGACCGA
AGTATGGTTCGATCCGGCCGGCAAACCTCACGACTGA
 Primer design