SecReT4
Protein ID: 334143078
T4SS name [ID]VirB [27]
Gene symbol-
Locus tagPP1Y_Spl337
StrainNovosphingobium sp. PP1Y
Repliconplasmid Spl [GenBank: NC_015582] [Browse all T4SS(s) in this replicon]
Location [Strand]33106..33783 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDF6IBW3
KEGG IDnpp:PP1Y_Spl337
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.2e-60, Aligned region: 16..224
Protein Sequence: 225 a.a.     [Download]
>gi|334143078|ref|YP_004537954.1| type IV secretion system protein VirB8 [Novosphingobium sp. PP1Y]
MAQVKAADKGTYLESARTFEYDRMRAAIQSRRVAWTVAGCACAMALVATGAVAMLAPLKTVEPYVIRVDK
STGETQVVTALKGPQPQTYDDAVNRFFVAQYIRLREGWLDDAARENAYAVMLMSDKAEGSRYLGSVKSSN
EKAPSNIYGDKGFVSIHIRAISFLSPTVAQVRYAKLLTMGQNTPTAQNWTATLTFKFTTAPTLEKDRLIN
PLGFEVVNFHSDPET
 
Nucleotide Sequence: 678 bp     [Download]
>gi|334143044|ref|NC_015582.1|:c33783-33106 Novosphingobium sp. PP1Y plasmid Spl, complete sequence
ATGGCCCAGGTCAAAGCCGCCGACAAAGGCACGTACCTCGAAAGCGCACGGACCTTCGAATACGACCGGA
TGCGCGCGGCCATCCAGTCCCGGCGGGTGGCCTGGACGGTCGCTGGCTGCGCCTGCGCCATGGCGCTAGT
CGCGACTGGCGCTGTCGCCATGCTGGCACCGCTGAAAACGGTCGAGCCTTATGTGATCCGCGTCGACAAA
TCGACCGGAGAAACGCAGGTCGTGACTGCGCTCAAGGGCCCGCAGCCCCAGACTTATGACGATGCGGTCA
ACCGATTCTTCGTGGCGCAGTACATTCGCCTACGCGAAGGCTGGCTCGACGATGCCGCGCGCGAGAACGC
CTATGCGGTCATGCTCATGAGCGACAAGGCCGAAGGCTCGCGCTACCTTGGTAGCGTCAAGTCGAGCAAC
GAGAAGGCCCCCTCCAACATCTACGGGGACAAGGGCTTCGTCTCGATCCACATTCGCGCGATCAGCTTCC
TGAGCCCGACCGTCGCGCAGGTCCGCTACGCCAAGCTCCTCACGATGGGCCAGAACACGCCCACGGCGCA
GAACTGGACCGCCACCCTCACCTTCAAGTTCACGACAGCGCCAACGCTGGAGAAGGACCGGCTGATCAAT
CCGCTCGGCTTCGAGGTCGTGAATTTCCACTCGGACCCGGAGACCTGA
 Primer design