SecReT4
Protein ID: 33594647
T4SS name [ID]Ptl [386]
Gene symbol-
Locus tagBP3792
StrainBordetella pertussis Tohama I
Repliconchromosome [GenBank: NC_002929] [Browse all T4SS(s) in this replicon]
Location [Strand]3995943..3996128 [+]
Productsecretion system protein
Component typePtlI
UniProt IDQ7VSX7
KEGG IDbpe:BP3792
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 61 a.a.     [Download]
>gi|33594647|ref|NP_882291.1| secretion system protein [Bordetella pertussis Tohama I]
MIHAHSNARLLRWAILAIAPVTLGACAPNGPPGLPYPDGKPLIPINTAAPEQGSSCQTRAP
 
Nucleotide Sequence: 186 bp     [Download]
>gi|33591275|ref|NC_002929.2|:3995943-3996128 Bordetella pertussis Tohama I chromosome, complete genome
ATGATCCACGCACATTCCAACGCCAGATTATTGCGATGGGCCATCCTGGCCATCGCCCCCGTCACGCTCG
GCGCCTGCGCCCCGAACGGGCCGCCCGGCTTGCCGTATCCCGATGGCAAGCCCCTGATTCCCATCAACAC
CGCCGCCCCGGAGCAAGGATCGTCATGCCAGACCCGCGCCCCTTGA
 Primer design