SecReT4
Protein ID: 33594648
T4SS name [ID]Ptl [386]
Gene symbol-
Locus tagBP3793
StrainBordetella pertussis Tohama I
Repliconchromosome [GenBank: NC_002929] [Browse all T4SS(s) in this replicon]
Location [Strand]3996107..3996808 [+]
Productsecretion system protein
Component typePtlE
UniProt IDQ7VSX6
KEGG IDbpe:BP3793
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.1e-65, Aligned region: 21..229
Protein Sequence: 233 a.a.     [Download]
>gi|33594648|ref|NP_882292.1| secretion system protein [Bordetella pertussis Tohama I]
MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATMLPLKTTIPYL
IEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHDYDYVRLLSAPAVRHDYETSY
EAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRRDADGQGAAESSIWVATVAFAYDQPRALTQA
QRWLNPLGFAVTSYRVDAEAGQP
 
Nucleotide Sequence: 702 bp     [Download]
>gi|33591275|ref|NC_002929.2|:3996107-3996808 Bordetella pertussis Tohama I chromosome, complete genome
ATGCCAGACCCGCGCCCCTTGACGCCTGACCAGACGCATGGCCGCGGGCATGCCGAGGCCGCGGTGGACT
GGGAAGCGTCCCGCCTGTACCGGCTGGCGCAGTCGGAACGCCGTGCATGGACGGTGGCGTGGGCGGCGCT
CGCCGTGACCGCGCTGTCATTGATCGCCATCGCGACGATGCTTCCGCTCAAGACCACCATTCCTTACCTG
ATCGAGGTCGAAAAGAGCAGCGGCGCGGCCTCGGTCGTCACGCAATTCGAACCCCGAGATTTCACCCCGG
ACACCTTGATGAACCAGTACTGGCTGACGCGCTATGTCGCGGCGCGCGAGCGCTACGATTGGCACACGAT
CCAGCACGATTACGACTACGTGCGCCTGCTGTCCGCGCCCGCCGTCAGGCACGATTACGAAACCAGCTAC
GAGGCGCCCGATGCGCCGGACCGCAAGTACGGCGCTGGCACGACCCTGGCCGTGAAAATTCTCAGCGCCA
TCGACCATGGCAAGGGCGTCGGCACGGTGCGCTTTGTCCGGACACGGCGCGACGCGGACGGGCAGGGCGC
CGCCGAATCCTCGATATGGGTAGCGACCGTGGCATTCGCCTACGATCAGCCGCGCGCGCTGACCCAGGCC
CAGCGCTGGCTCAATCCGCTGGGCTTTGCCGTCACCAGCTATCGCGTCGACGCGGAGGCTGGACAGCCAT
GA
 Primer design