SecReT4
Protein ID: 33594649
T4SS name [ID]Ptl [386]
Gene symbol-
Locus tagBP3794
StrainBordetella pertussis Tohama I
Repliconchromosome [GenBank: NC_002929] [Browse all T4SS(s) in this replicon]
Location [Strand]3996805..3997626 [+]
Productsecretion system protein
Component typePtlF
UniProt IDQ7VSX5
KEGG IDbpe:BP3794
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.1e-61, Aligned region: 30..255
Protein Sequence: 273 a.a.     [Download]
>gi|33594649|ref|NP_882293.1| secretion system protein [Bordetella pertussis Tohama I]
MMAARMMAAGLAATALSAHAFRIPTPGEQDARIQTVPYHPEEVVLVRAWNGYVTRIVFDEQEKIIDVAAG
FADGWQFSPEGNVLYIKAKSFPAQGSPAQAPEPGLWNTNLLVKTDRRLYDFDLVLASADAATPQALQRSR
MAYRLQFRYPAAPQAASRASPVGPAVPAGALNRRYAMQVGNGSDGIAPIAAYDDGRHTWLTFRPGQPFPA
VFAVAPDGTETLVNLHIDNQSLVIHRVAPVLMLRSGASVIRIVNQNGDASESPAFECHAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|33591275|ref|NC_002929.2|:3996805-3997626 Bordetella pertussis Tohama I chromosome, complete genome
ATGATGGCGGCACGGATGATGGCGGCCGGCCTGGCGGCCACGGCGCTTTCGGCGCATGCGTTCCGGATAC
CCACGCCAGGAGAACAGGACGCCCGCATACAGACCGTGCCGTACCACCCGGAGGAGGTGGTGCTGGTGCG
CGCCTGGAACGGCTACGTCACCCGGATCGTATTCGACGAGCAGGAGAAGATCATCGACGTCGCCGCGGGG
TTCGCCGACGGCTGGCAATTCAGCCCGGAAGGCAATGTGCTGTATATCAAGGCCAAATCCTTCCCCGCGC
AGGGCTCGCCCGCGCAGGCGCCGGAGCCGGGATTGTGGAACACCAATCTGCTCGTCAAAACCGACCGCCG
GCTCTACGACTTCGACCTGGTGCTGGCCAGCGCGGACGCGGCGACACCGCAGGCGTTGCAGCGTTCGCGC
ATGGCCTATCGCCTGCAATTCCGCTACCCGGCCGCGCCGCAGGCGGCATCCCGCGCCAGCCCCGTCGGCC
CGGCTGTTCCCGCCGGCGCATTGAACCGGCGCTACGCCATGCAGGTGGGCAACGGGTCGGACGGCATCGC
ACCCATCGCTGCGTACGACGACGGCCGGCATACCTGGCTCACGTTCAGACCGGGTCAGCCGTTTCCGGCC
GTATTCGCGGTAGCGCCGGACGGAACGGAAACCCTGGTCAATCTGCATATCGACAACCAATCACTGGTCA
TACACCGGGTAGCGCCGGTCCTGATGCTGCGGTCCGGCGCCAGCGTCATCCGGATCGTCAACCAGAACGG
CGATGCGTCCGAGTCCCCAGCCTTCGAATGCCATGCTGAACCGGCCCTCTAG
 Primer design