SecReT4
Protein ID: 33598793
T4SS name [ID]Ptl [387]
Gene symbolptlA
Locus tagBPP4309
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4640447..4640755 [+]
Producttoxin transport protein
Component typePtlA
UniProt IDQ7W2U5
KEGG IDbpa:BPP4309
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-17, Aligned region: 7..99
Protein Sequence: 102 a.a.     [Download]
>gi|33598793|ref|NP_886436.1| ptlA gene product [Bordetella parapertussis 12822]
MNPLKDLRASLPRLAFMAACTLLSATLPDLAQAGGGLQRVNHFMASIVVVLRGASVATVTIAIIWAGYKL
LFRHADVLDVVRVVLAGLLIGASAEIARYLLT
 
Nucleotide Sequence: 309 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4640447-4640755 Bordetella parapertussis 12822 chromosome, complete genome
ATGAATCCCTTGAAAGACTTGAGAGCATCGCTACCGCGCCTGGCCTTCATGGCAGCCTGCACCCTGTTGT
CCGCCACGCTGCCCGACCTCGCCCAGGCCGGCGGCGGGCTGCAGCGCGTCAACCACTTCATGGCGAGCAT
CGTGGTCGTACTGCGCGGCGCGTCAGTGGCCACGGTGACCATCGCCATAATCTGGGCGGGCTACAAGCTG
CTGTTCCGGCACGCCGATGTGCTGGACGTGGTGCGAGTGGTGCTGGCGGGACTGCTGATCGGCGCATCGG
CCGAAATCGCTCGTTATCTGCTGACCTGA
 Primer design