SecReT4
Protein ID: 33598794
T4SS name [ID]Ptl [387]
Gene symbolptlB
Locus tagBPP4310
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4640774..4641088 [+]
Producttoxin transport protein
Component typePtlB
UniProt IDQ7W2U4
KEGG IDbpa:BPP4310
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.2e-25, Aligned region: 3..86
Protein Sequence: 104 a.a.     [Download]
>gi|33598794|ref|NP_886437.1| ptlB gene product [Bordetella parapertussis 12822]
MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDDQQFRLIWLYL
RMRWLSRDRTHAFWQSTVYAPLRYAERRRRLRKP
 
Nucleotide Sequence: 315 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4640774-4641088 Bordetella parapertussis 12822 chromosome, complete genome
ATGCGTGATCCGCTTTTCAAGGGCTGCACCCGGCCCGCGATGCTGATGGGCGTACCCGCCACGCCGCTGG
CCGTGTGCAGCGGCACCATTGCCCTGCTGGGCATCTGGTTCAGCATCGCCTTTCTGGCCTTGTTTCCCGT
GGCATTGCTGGCGATGCGGATCATGATCCGGCGCGATGACCAGCAGTTCCGCCTGATCTGGCTTTACCTG
CGCATGCGTTGGCTGAGCCGGGACCGCACGCATGCGTTCTGGCAAAGTACCGTCTATGCGCCGCTGCGTT
ACGCCGAGCGCCGCCGGCGCCTGCGCAAGCCATGA
 Primer design