SecReT4
Protein ID: 33598795
T4SS name [ID]Ptl [387]
Gene symbol-
Locus tagBPP4311
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4641085..4643559 [+]
Productsecretion system protein
Component typePtlC
UniProt IDQ7W2U3
KEGG IDbpa:BPP4311
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.5e-53, Aligned region: 188..387
AAA_10 [PF12846], Evalue: 1.3e-28, Aligned region: 451..739
Protein Sequence: 824 a.a.     [Download]
>gi|33598795|ref|NP_886438.1| unnamed protein product [Bordetella parapertussis 12822]
MNRRGGQTAFAAIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNG
LWRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVYRPGHAALGK
RAHHGQAEVRRQLLAHVRRMDEIGSLIETTLRSHGENHEQAITVLGCETDSAGRRYSRTLTLLEFLLTGH
WQPVRVPAGPVDAYLGSSRILAGAEMMELRSPTCRRYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHS
FSAVGKRQALAYLQRQRAQLANVQDAAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVS
SAMTRIQERGFLATPVTLALDAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALS
LLSTPSGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLTTIFFD
KDRGAEICIRALDGQYLRIRDGEPTGFNPLQLPCTDRNVMFLDSLLAMLARAHDSPLTSAQHATLATAVR
TVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGGTGMLWWVFDNPNDCLDFSRPGNYGID
GTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYLMDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQ
MPSSLLGARVAASLVQQCATEIYLPNPRADRAEYLDGFKCTETEYQLIRSMAEDSHLFLVKQGRQAVVAQ
LDLSGMDDELAILSGNARNLRCFEQALALTRERDPNDWIAVFHRLRREASAGLR
 
Nucleotide Sequence: 2475 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4641085-4643559 Bordetella parapertussis 12822 chromosome, complete genome
ATGAACCGGCGCGGCGGCCAGACCGCATTTGCGGCCATTGCGCGCAACGAGCGCGCCATCGCTGCGTTCA
TCCCCTACAGCAGCCACCTGACGGACACGACGCTGATCACCCATGGCGCGGACCTGGTCCGCACCTGGCG
CGTACAGGGGATCGCCTTCGAAAGCGCCGAGCCAGAGCTGGTTTCGCAGCGCCATGAACAGCTCAACGGC
CTGTGGCGCGCCATCTCGTGCGAGCAGGTCGCACTTTGGATCCATTGCATCCGGCGCAAGACGCAGGCCG
GGTTGGATGCGCGGTACGAAAATCCGTTCTGCCGCGCGCTCGACGCCTCGTACAACGCCCGGCTGAACGC
GCGGCAGGCAATGACGAATGAGTTCTACCTCACCCTGGTATATCGGCCTGGCCACGCCGCGCTCGGCAAG
CGTGCGCATCACGGCCAGGCCGAGGTCCGCCGGCAACTGCTGGCCCATGTACGACGCATGGACGAAATCG
GATCCCTGATCGAAACGACGCTGCGCAGCCATGGCGAGAACCACGAGCAGGCCATCACCGTGCTGGGCTG
CGAGACGGACAGCGCCGGCCGGCGATACTCCCGGACGCTGACCCTGCTCGAATTCCTGCTCACCGGCCAC
TGGCAGCCGGTACGTGTGCCGGCCGGGCCGGTGGACGCGTATCTCGGTTCGAGCCGGATCCTTGCCGGCG
CCGAAATGATGGAGTTGCGTTCTCCGACCTGCCGCCGCTACGCGCAGTTCATCGATTTCAAGGAATACGG
CACGCACACCGAACCAGGGATGCTGAATGCCTTGCTGTACGAGGATTACGAATATGTGATCACGCATTCG
TTCAGCGCGGTCGGCAAGCGACAGGCGCTGGCCTACCTGCAGCGGCAGCGCGCCCAGCTGGCCAACGTGC
AGGACGCCGCGTACTCGCAGATCGACGACCTCGCGCATGCCGAAGACGCCCTGGTCAATGGCGATTTCGT
GATCGGCGAGTATCACTTCTCGATGATGATCCTCGGCGCCGACCCCCGGCAACTGCGGCGCGATGTCAGT
TCGGCCATGACGCGCATCCAGGAGCGCGGCTTTCTCGCCACGCCGGTGACGTTGGCCCTGGATGCCGCCT
TCTATGCGCAATTGCCTGCCAACTGGGCATACCGGCCGCGCAAGGCCATGTTGACCAGCAGAAACTTCGC
CGGACTGTGCAGCTTTCATAATTTCTACGGCGGCAAGCGCGATGGCAACCCCTGGGGCCCGGCCCTGAGC
CTGCTGTCCACGCCTTCCGGCCAACCGTTCTACTTCAATTTCCATCACTCCGGGCTCGACGAGGATTGCC
GCGGCCAGATGATGCTGGGCAACACGCGCATCATCGGCCAGTCCGGCAGCGGCAAGACCGTGCTGCTCAA
TTTCCTGCTTTGCCAGCTGCAGAAATTCCGATCCGCGGATGCCGATGGCCTGACGACGATTTTCTTCGAC
AAGGACCGGGGCGCGGAAATCTGCATCCGCGCCCTCGATGGCCAGTACTTGCGGATACGCGACGGCGAAC
CGACCGGCTTCAACCCCTTGCAGCTGCCATGCACCGACCGCAATGTCATGTTCCTGGACTCGCTTCTGGC
GATGCTCGCGCGCGCTCATGACTCGCCGCTGACGTCGGCGCAGCACGCGACGCTAGCCACCGCTGTGCGC
ACGGTGCTGCGCATGCCGGCGTCGCTGCGGCGAATGTCCACGCTGCTGCAAAACATCACCCAGGCCACGT
CCGAGCAGCGGGAACTGGTCAGACGCCTGGGGCGCTGGTGCCGCGACGACGGCGCCGGTGGCACGGGAAT
GCTGTGGTGGGTCTTCGACAATCCGAATGATTGCCTCGATTTTTCGCGGCCGGGCAACTACGGCATCGAC
GGCACCGCGTTCCTGGACAATGCCGAGACGCGCACACCGATCTCGATGTACCTGTTGCATCGGATGAACG
AGGCCATGGATGGACGGCGCTTCGTCTATCTCATGGACGAAGCCTGGAAGTGGATCGACGACCCGGCCTT
CGCCGAGTTCGCAGGCGACCAGCAGCTGACCATACGCAAGAAGAACGGGCTGGGCGTCTTCTCCACGCAA
ATGCCAAGCAGCCTGCTCGGCGCGAGGGTCGCCGCATCGCTGGTACAGCAATGCGCAACCGAGATCTATC
TGCCCAACCCCAGGGCCGATCGCGCCGAATACCTGGATGGTTTCAAATGCACCGAAACCGAGTACCAGTT
GATCCGCTCCATGGCGGAGGACAGCCATCTTTTTCTCGTCAAACAGGGCAGGCAGGCAGTCGTCGCACAA
CTCGACCTCTCCGGCATGGATGACGAATTGGCCATCCTGTCCGGCAACGCCAGGAACCTGCGCTGTTTCG
AGCAAGCGCTGGCACTGACGCGGGAGCGCGACCCAAACGACTGGATCGCGGTATTCCATCGGCTTCGACG
CGAAGCCAGCGCCGGCCTCAGGTGA
 Primer design