SecReT4
Protein ID: 33598796
T4SS name [ID]Ptl [387]
Gene symbol-
Locus tagBPP4312
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4643567..4644958 [+]
Producthypothetical protein
Component typePtlD
UniProt IDQ7W2U2
KEGG IDbpa:BPP4312
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.6e-33, Aligned region: 126..356
Protein Sequence: 463 a.a.     [Download]
>gi|33598796|ref|NP_886439.1| unnamed protein product [Bordetella parapertussis 12822]
MAGLSRILLSCTLACLLAGQAAQASVDDPTRAGGDNRVRALRADQARRDVLLTACRDDPGHRRGEPDCVN
AERAQALQQWQAAAMTSVDAAFSDLAGALRNAAPRRMEAAIVRLTRQLQPLVYSMMTLLVLLTGYALLAR
RDRPFEWHIRHALLVAVVTSLALSPDHYLSTVVAGVQDVAGWLSGPWTAPDGAAGRGGLAQLDQFAAQAQ
AWVAQLAGQAANDANPGSAVNWLLCAMIVATSAGGWLCLAASLLIVPGLIVTLLLSLGPLFLVLLLFPAL
QRWTNAWLGALVRALVFMALGTPAVGLLSDVLAGALPAGLPQRFATDPLRSTMLAATLCATATLMLLTLV
PLASSVNAGLRRRLWPNAAHPGLAQAHRQAAARQYAPRPAAAAAAAGPHQAGTYAASATPAPAPARPAPS
FPAHAYRQYALGGARRPPPRVRRDDRPAPAPDRRVLPRKPNLP
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4643567-4644958 Bordetella parapertussis 12822 chromosome, complete genome
ATGGCCGGCCTGTCACGAATCCTGCTGTCCTGCACGCTTGCATGCCTGCTCGCCGGGCAGGCCGCCCAGG
CCTCCGTGGACGACCCCACCCGGGCTGGCGGCGACAATCGGGTACGGGCGCTGCGCGCCGACCAGGCGCG
ACGAGACGTCCTGCTCACCGCCTGCCGCGACGACCCCGGCCACCGGCGCGGTGAGCCGGATTGCGTCAAC
GCCGAGCGCGCCCAGGCGCTGCAGCAGTGGCAGGCCGCCGCCATGACCAGCGTGGATGCCGCCTTCTCCG
ATTTGGCTGGTGCGCTGCGCAATGCGGCGCCGCGGCGGATGGAGGCCGCGATCGTACGGCTGACGCGCCA
GCTCCAGCCGCTGGTCTATTCCATGATGACGCTGCTGGTACTGTTGACTGGCTATGCACTGCTGGCGCGA
CGCGACCGCCCGTTCGAATGGCATATCCGGCACGCCCTGCTGGTTGCGGTCGTGACCTCGCTGGCACTGT
CTCCCGACCACTACCTGTCCACCGTGGTGGCAGGCGTCCAGGACGTCGCGGGCTGGCTGAGCGGGCCCTG
GACAGCGCCGGACGGCGCGGCGGGGCGCGGCGGACTCGCGCAACTGGACCAGTTCGCCGCCCAGGCCCAG
GCCTGGGTCGCGCAACTGGCCGGCCAGGCCGCCAACGACGCCAACCCGGGCAGCGCCGTCAACTGGCTGC
TCTGCGCCATGATCGTGGCCACCAGCGCGGGAGGCTGGCTTTGCCTGGCGGCGTCCCTGCTGATCGTGCC
GGGCCTGATAGTCACGCTGCTGCTGTCGTTGGGGCCGCTCTTTCTCGTGCTGCTGCTGTTTCCCGCGCTG
CAGCGCTGGACCAACGCCTGGCTCGGCGCGCTGGTCCGCGCGCTCGTCTTCATGGCACTGGGCACGCCGG
CCGTCGGCCTACTGTCCGATGTACTGGCTGGCGCCTTGCCGGCCGGCCTGCCGCAGCGGTTTGCCACCGA
CCCGCTGCGCTCGACCATGCTGGCGGCAACGCTATGCGCCACGGCGACACTCATGCTGCTGACCCTGGTC
CCGCTGGCCAGCAGCGTCAACGCGGGCCTGCGGCGCCGCCTGTGGCCTAACGCGGCCCATCCCGGGCTCG
CGCAGGCTCATCGGCAAGCCGCCGCGCGCCAGTACGCCCCCCGTCCGGCCGCGGCGGCCGCCGCCGCGGG
ACCGCACCAGGCCGGTACGTACGCAGCCTCGGCCACGCCGGCGCCGGCGCCGGCCCGCCCGGCCCCATCC
TTCCCGGCGCACGCCTATAGGCAGTACGCCCTGGGCGGCGCGAGAAGGCCGCCGCCCAGGGTGCGACGCG
ACGACCGGCCCGCGCCGGCGCCGGACCGACGGGTTCTTCCCCGCAAACCCAACCTGCCATGA
 Primer design