SecReT4
Protein ID: 33598797
T4SS name [ID]Ptl [387]
Gene symbol-
Locus tagBPP4312A
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4644955..4645140 [+]
Productsecretion system protein
Component typePtlI
UniProt IDQ7W2U1
KEGG IDbpa:BPP4312A
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 61 a.a.     [Download]
>gi|33598797|ref|NP_886440.1| unnamed protein product [Bordetella parapertussis 12822]
MIHAHSNARLLRWAILAIAPVTLGACAPNGPPGLPYPDGKPLIPINTAAPEQGSSCQTRAP
 
Nucleotide Sequence: 186 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4644955-4645140 Bordetella parapertussis 12822 chromosome, complete genome
ATGATCCACGCACATTCCAACGCCAGATTATTGCGATGGGCCATCCTGGCCATCGCCCCCGTCACGCTCG
GCGCCTGCGCCCCGAACGGGCCGCCCGGCTTGCCGTATCCCGATGGCAAGCCCCTGATTCCCATCAACAC
CGCCGCCCCGGAGCAAGGATCGTCATGCCAGACCCGCGCCCCTTGA
 Primer design