SecReT4
Protein ID: 33598798
T4SS name [ID]Ptl [387]
Gene symbol-
Locus tagBPP4313
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4645119..4645820 [+]
Productsecretion system protein
Component typePtlE
UniProt IDQ7W2U0
KEGG IDbpa:BPP4313
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.1e-65, Aligned region: 21..229
Protein Sequence: 233 a.a.     [Download]
>gi|33598798|ref|NP_886441.1| unnamed protein product [Bordetella parapertussis 12822]
MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATMLPLKTTIPYL
IEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHDYDYVRLLSAPAVRHDYETSY
EAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRRDADGQGAAESSIWVATVAFAYDQPRALTQA
QRWLNPLGFAVTSYRVDAEAGQP
 
Nucleotide Sequence: 702 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4645119-4645820 Bordetella parapertussis 12822 chromosome, complete genome
ATGCCAGACCCGCGCCCCTTGACGCCTGACCAGACGCATGGCCGCGGGCATGCCGAGGCCGCGGTGGACT
GGGAAGCGTCCCGCCTGTACCGGCTGGCGCAGTCGGAACGCCGTGCATGGACGGTGGCGTGGGCGGCGCT
CGCCGTGACCGCGCTGTCATTGATCGCCATCGCGACGATGCTTCCGCTCAAGACCACCATTCCTTACCTG
ATCGAGGTCGAAAAGAGCAGCGGCGCGGCCTCGGTCGTCACGCAATTCGAACCCCGAGATTTCACCCCGG
ACACCTTGATGAACCAGTACTGGCTGACGCGCTATGTCGCGGCGCGCGAGCGCTACGATTGGCACACGAT
CCAGCACGATTACGACTACGTGCGCCTGCTGTCCGCGCCCGCCGTCAGGCACGATTACGAAACCAGCTAC
GAGGCGCCCGATGCGCCGGACCGCAAGTACGGCGCTGGCACGACCCTGGCCGTGAAAATTCTCAGCGCCA
TCGACCATGGCAAGGGCGTCGGCACGGTGCGCTTTGTCCGGACACGGCGCGACGCGGACGGGCAGGGCGC
CGCCGAATCCTCGATATGGGTAGCGACCGTGGCATTCGCCTACGATCAGCCGCGCGCGCTGACCCAGGCC
CAGCGCTGGCTCAATCCGCTGGGCTTTGCCGTCACCAGCTATCGCGTCGACGCGGAGGCTGGACAGCCAT
GA
 Primer design