SecReT4
Protein ID: 33598799
T4SS name [ID]Ptl [387]
Gene symbol-
Locus tagBPP4314
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4645817..4646638 [+]
Productsecretion system protein
Component typePtlF
UniProt IDQ7W2T9
KEGG IDbpa:BPP4314
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.1e-61, Aligned region: 30..255
Protein Sequence: 273 a.a.     [Download]
>gi|33598799|ref|NP_886442.1| unnamed protein product [Bordetella parapertussis 12822]
MMAARMMAAGLAATALSAHAFRIPTPGEQDARIQTVPYHPEEVVLVRAWNGYVTRIVFDEQEKIIDVAAG
FADGWQFSPEGNVLYIKAKSFPAQGSPAQAPEPGLWNTNLLVKTDRRLYDFDLVLASADAATPQALQRSR
MAYRLQFRYPAAPQAASRASPVGPAVPAGALNRRYAMQVGNGSDGIAPIAAYDDGRHTWLTFRPGQPFPA
VFAVAPDGTETLVNLHIDNQSLVIHRVAPVLMLRSGASVIRIVNQNGDASASPAFECHAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4645817-4646638 Bordetella parapertussis 12822 chromosome, complete genome
ATGATGGCGGCACGGATGATGGCGGCCGGCCTGGCGGCCACGGCGCTTTCGGCGCATGCGTTCCGGATAC
CCACGCCAGGAGAACAGGACGCCCGCATACAGACCGTGCCGTACCACCCGGAGGAGGTGGTGCTGGTGCG
CGCCTGGAACGGCTACGTCACCCGGATCGTATTCGACGAGCAGGAGAAGATCATCGACGTCGCCGCGGGG
TTCGCCGACGGCTGGCAATTCAGCCCGGAAGGCAATGTGCTGTATATCAAGGCCAAATCCTTCCCCGCGC
AGGGCTCGCCCGCGCAGGCGCCGGAGCCGGGATTGTGGAACACCAATCTGCTCGTCAAAACCGACCGCCG
GCTCTACGACTTCGACCTGGTGCTGGCCAGCGCGGACGCGGCGACACCGCAGGCGTTGCAGCGTTCGCGC
ATGGCCTATCGCCTGCAATTCCGCTACCCGGCCGCGCCGCAGGCGGCATCCCGCGCCAGCCCCGTCGGCC
CGGCTGTTCCCGCCGGCGCATTGAACCGGCGCTACGCCATGCAGGTGGGCAACGGGTCGGACGGCATCGC
ACCCATCGCTGCGTACGACGACGGCCGGCATACCTGGCTCACGTTCAGACCGGGTCAGCCGTTTCCGGCC
GTATTCGCGGTAGCGCCGGACGGAACGGAAACCCTGGTCAATCTGCATATCGACAACCAATCACTGGTCA
TACACCGGGTAGCGCCGGTCCTGATGCTGCGGTCCGGCGCCAGCGTCATCCGGATCGTCAACCAGAACGG
CGATGCGTCCGCGTCCCCAGCCTTCGAATGCCATGCTGAACCGGCCCTCTAG
 Primer design