SecReT4
Protein ID: 33598800
T4SS name [ID]Ptl [387]
Gene symbol-
Locus tagBPP4315
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4646619..4647743 [+]
Productsecretion system protein
Component typePtlG
UniProt IDQ7W2T8
KEGG IDbpa:BPP4315
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.7e-55, Aligned region: 189..366
Protein Sequence: 374 a.a.     [Download]
>gi|33598800|ref|NP_886443.1| unnamed protein product [Bordetella parapertussis 12822]
MLNRPSSPDGGEAHAWPPDPEIPVFANAEHAHRRPLRWMFALVAVALSCLLATGIWRSRAAPPHAATQTV
APAGQALPPGRMFTVHPREPEPAPLPDMPAAPNPILPQPRPAPPVPPPPIRAPYDYDEPAPRRDSAALKS
GPAMMVATAARLGQTERAGMAEDGVSADAATLIGRSVSRATRSGGRDYRLLPGTFIDCILQTRIVTNVPG
LTTCIVSRDVYSASGKRVLVPRGTTVVGEYRADLAQGSQRIYVAWSRLFMPSGLTIELASPAVDGTGAAG
LPGVVDDKFAQRFGGALLLSVLGDATSYMLARATDARHGVNVNLTAAGTMNSLAASALNNTINIPPTLYK
NHGDQIGILVARPLDFSILRGTNE
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4646619-4647743 Bordetella parapertussis 12822 chromosome, complete genome
ATGCTGAACCGGCCCTCTAGTCCCGATGGCGGCGAAGCGCACGCTTGGCCGCCGGACCCCGAAATCCCTG
TTTTCGCCAATGCCGAGCATGCGCATCGGCGTCCGCTGCGCTGGATGTTCGCCCTTGTCGCCGTGGCCCT
GTCATGCCTGCTGGCAACGGGGATATGGCGCAGCCGCGCCGCGCCGCCGCACGCCGCGACGCAGACCGTC
GCGCCGGCGGGGCAAGCCCTGCCGCCGGGGCGCATGTTCACGGTCCACCCACGCGAACCCGAACCGGCGC
CGCTTCCGGACATGCCGGCGGCTCCCAACCCGATCCTGCCGCAGCCGCGGCCGGCGCCACCCGTCCCGCC
CCCGCCAATCCGCGCGCCGTACGACTACGATGAACCGGCGCCCCGGCGCGACAGCGCGGCGCTCAAGTCC
GGCCCGGCCATGATGGTCGCCACGGCCGCGCGCCTTGGACAAACCGAGCGGGCGGGCATGGCGGAAGACG
GCGTGTCCGCGGATGCGGCCACCCTCATCGGCAGGAGCGTCAGCCGCGCAACCCGCTCCGGGGGCCGCGA
TTACCGGCTGCTGCCCGGCACGTTTATCGATTGCATCCTGCAGACCCGGATCGTCACCAACGTCCCGGGG
CTGACGACCTGCATCGTATCGCGGGATGTCTACAGCGCCAGCGGCAAGCGCGTCCTGGTGCCGCGTGGCA
CGACAGTGGTGGGCGAATACCGCGCCGACCTGGCGCAGGGCTCGCAACGCATCTACGTCGCATGGAGCCG
GCTTTTCATGCCGTCCGGGCTCACGATAGAGCTGGCATCGCCGGCCGTGGACGGAACCGGCGCCGCGGGG
CTGCCCGGCGTGGTGGACGACAAATTCGCGCAGCGTTTCGGCGGCGCCCTGCTGCTGAGCGTATTGGGCG
ATGCCACCTCGTACATGCTGGCGCGCGCCACCGATGCGCGCCACGGCGTGAACGTGAACCTTACCGCCGC
GGGAACGATGAATTCGCTGGCCGCCAGCGCCCTGAACAACACGATCAACATCCCGCCCACGCTCTACAAG
AACCACGGCGACCAGATCGGCATCCTGGTCGCCCGTCCATTGGACTTCTCCATACTCAGGGGGACGAATG
AATGA
 Primer design