SecReT4
Protein ID: 33598801
T4SS name [ID]Ptl [387]
Gene symbol-
Locus tagBPP4316
StrainBordetella parapertussis 12822
Repliconchromosome [GenBank: NC_002928] [Browse all T4SS(s) in this replicon]
Location [Strand]4647736..4648755 [+]
Productsecretion system protein
Component typePtlH
UniProt IDQ7W2T7
KEGG IDbpa:BPP4316
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.8e-67, Aligned region: 17..318
Zeta_toxin [PF06414], Evalue: 2.4e-05, Aligned region: 163..197
AAA_29 [PF13555], Evalue: 3.5e-05, Aligned region: 161..184
Protein Sequence: 339 a.a.     [Download]
>gi|33598801|ref|NP_886444.1| unnamed protein product [Bordetella parapertussis 12822]
MNDAAPDRQASVDFHLQALHPWLSRQDIAEICVNRPGQLWYEDRNGWNRQESGALTLDHLHALATATARF
CDRDICPERPLLAASLPGGERVQIVVPPACEPGTLSLTIRKPARRIWPLSELLRDTLDLPGVPGASQARP
DPLLDPWRRGAWDDFLRLAVQAGKAILVAGQTGSGKTTLMNALSGEIPPRERIVTIEDVRELRLDPATNH
VHLLYGTPTEGRTAAVSATELLRAALRMAPTRILLAELRGGEAFDFLQACASGHSGGISTCHAASADMAL
QRLTLMCMQHPNCQMLPYSTLRALVESVIDIVVVVERRAGQGARRRVVDIWYRDGLPAP
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|33594723|ref|NC_002928.3|:4647736-4648755 Bordetella parapertussis 12822 chromosome, complete genome
ATGAATGATGCCGCGCCGGATCGACAGGCATCGGTCGACTTCCACCTCCAAGCGCTGCATCCGTGGCTGA
GCCGGCAGGATATAGCGGAAATCTGCGTGAACCGTCCGGGGCAGCTCTGGTATGAAGACCGCAACGGCTG
GAACCGCCAGGAGTCGGGCGCGCTCACGCTTGATCATCTGCACGCCCTGGCTACCGCGACGGCCCGGTTC
TGCGACCGCGACATTTGCCCGGAGCGTCCCTTGCTGGCGGCGTCCCTGCCTGGCGGCGAACGGGTGCAGA
TCGTCGTCCCTCCAGCCTGCGAACCGGGCACGCTGTCGCTGACCATCCGCAAGCCCGCCCGGCGCATCTG
GCCACTATCGGAACTGTTGCGCGATACGCTCGACCTGCCAGGCGTCCCGGGCGCCAGCCAAGCGCGGCCA
GACCCCTTGCTCGACCCGTGGAGGCGCGGCGCATGGGACGACTTCCTGCGGCTGGCCGTGCAGGCGGGCA
AGGCCATACTCGTCGCCGGCCAGACCGGTTCGGGCAAGACCACATTGATGAACGCGTTGAGCGGGGAGAT
TCCGCCCCGCGAACGCATCGTCACGATCGAGGACGTGCGCGAGTTGCGGCTGGATCCGGCAACCAATCAC
GTACACCTGTTGTACGGCACTCCGACGGAAGGCAGGACGGCCGCCGTATCGGCCACCGAGCTGTTGCGCG
CGGCGCTGCGCATGGCGCCCACGCGCATCCTGCTGGCGGAGCTGCGCGGGGGAGAAGCCTTCGACTTCCT
CCAGGCATGCGCGTCCGGACACAGCGGCGGCATCAGCACCTGCCATGCCGCCAGCGCCGATATGGCGCTG
CAGCGGCTGACGCTGATGTGCATGCAACACCCGAATTGCCAGATGCTTCCCTACTCGACGCTACGCGCGC
TGGTCGAATCCGTGATCGATATCGTCGTGGTGGTGGAGCGCCGAGCCGGGCAGGGGGCCCGGCGGCGGGT
CGTCGACATCTGGTACCGGGATGGCCTCCCGGCGCCATGA
 Primer design