SecReT4
Protein ID: 33603868
T4SS name [ID]Ptl [379]
Gene symbolptlA
Locus tagBB4895
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5202140..5202448 [+]
Producttoxin transport protein
Component typePtlA
UniProt IDQ7WDU3
KEGG IDbbr:BB4895
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.5e-19, Aligned region: 10..99
Protein Sequence: 102 a.a.     [Download]
>gi|33603868|ref|NP_891428.1| ptlA gene product [Bordetella bronchiseptica RB50]
MNRLKDLGTPRPRLAFMAACILLLATLPDFAQASGGLQRVNSFMAGIVTVLRGASVATVTIAIIWAGYKL
LFRHADVLDVVRVVLAGLLIGASAEIARYLLT
 
Nucleotide Sequence: 309 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5202140-5202448 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGAACCGCTTGAAAGACTTGGGAACGCCACGGCCGCGCCTGGCCTTCATGGCAGCCTGCATCCTGTTGC
TGGCCACGCTGCCCGACTTCGCCCAGGCGAGCGGCGGCCTGCAACGCGTCAACAGCTTCATGGCGGGGAT
CGTCACCGTGCTGCGCGGCGCATCGGTGGCCACGGTCACCATCGCCATCATATGGGCCGGCTACAAGCTG
CTGTTCCGGCACGCCGATGTGCTGGACGTGGTGCGAGTGGTGCTGGCGGGACTGCTGATCGGCGCATCGG
CCGAAATCGCCCGTTATCTGCTGACCTGA
 Primer design