SecReT4
Protein ID: 33603869
T4SS name [ID]Ptl [379]
Gene symbolptlB
Locus tagBB4896
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5202467..5202781 [+]
Producttoxin transport protein
Component typePtlB
UniProt IDQ7WDU2
KEGG IDbbr:BB4896
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.2e-25, Aligned region: 3..86
Protein Sequence: 104 a.a.     [Download]
>gi|33603869|ref|NP_891429.1| ptlB gene product [Bordetella bronchiseptica RB50]
MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDDQQFRLIWLYL
RMRWLSRDRTHAFWQSTVYAPLRYAERRQRLRKP
 
Nucleotide Sequence: 315 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5202467-5202781 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGCGTGATCCGCTTTTCAAGGGCTGCACCCGTCCCGCGATGCTGATGGGCGTACCCGCCACGCCGCTGG
CCGTGTGCAGCGGCACCATTGCCCTGCTGGGCATCTGGTTCAGCATCGCCTTTCTGGCCTTGTTTCCCGT
GGCATTGCTGGCGATGCGGATCATGATCCGGCGCGATGACCAGCAGTTCCGCCTGATCTGGCTTTACCTG
CGCATGCGTTGGCTGAGCCGGGACCGCACGCATGCGTTCTGGCAAAGTACCGTCTATGCGCCGCTGCGTT
ACGCCGAGCGCCGCCAGCGCCTGCGCAAGCCATGA
 Primer design