SecReT4
Protein ID: 33603870
T4SS name [ID]Ptl [379]
Gene symbol-
Locus tagBB4897
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5202778..5205252 [+]
Productsecretion system protein
Component typePtlC
UniProt IDQ7WDU1
KEGG IDbbr:BB4897
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 9.3e-54, Aligned region: 188..387
AAA_10 [PF12846], Evalue: 8.2e-29, Aligned region: 451..739
Protein Sequence: 824 a.a.     [Download]
>gi|33603870|ref|NP_891430.1| unnamed protein product [Bordetella bronchiseptica RB50]
MNRRGGQTAFAAIARNERAIAAFIPYSSHLTDTTLITHGADLVRTWRVQGIAFESAEPELVSQRHEQLNG
LWRAISCEQVALWIHCIRRKTQAGLDARYENPFCRALDASYNARLNARQAMTNEFYLTLVYRPGHAALGK
RAHHGQAEVRRQLLAHVRRMDEIGSLIETTLRSHGEDHEQAITVLGCETDSAGRRYSRTLTLLEFLLTGH
WQPVRVPAGPLDAYLGSSRILAGAEMMELRSPTCRRYAQFIDFKEYGTHTEPGMLNALLYEDYEYVITHS
FSAVGKRQALAYLQRQRAQLANVQDAAYSQIDDLAHAEDALVNGDFVIGEYHFSMMILGADPRQLRRDVS
SAMTRIQERGFLATPVTLALDAAFYAQLPANWAYRPRKAMLTSRNFAGLCSFHNFYGGKRDGNPWGPALS
LLSTPSGQPFYFNFHHSGLDEDCRGQMMLGNTRIIGQSGSGKTVLLNFLLCQLQKFRSADADGLTTIFFD
KDRGAEICIRALDGQYLRIRDGEPTGFNPLQLPCTDRNVMFLDSLLAMLARAHDSPLTSAQHATLATAVR
TVLRMPASLRRMSTLLQNITQATSEQRELVRRLGRWCRDDGAGGTGMLWWVFDNPNDCLDFSRPGNYGID
GTAFLDNAETRTPISMYLLHRMNEAMDGRRFVYLMDEAWKWIDDPAFAEFAGDQQLTIRKKNGLGVFSTQ
MPSSLLGARVAASLVQQCATEIYLPNPRADRAEYLDGFKCTETEYQLIRSMAEDSHLFLVKQGRQAVVAQ
LDLSGMDDELAILSGNARNLRCFEQALALTRERDPNDWIAVFHRLRREASAGLR
 
Nucleotide Sequence: 2475 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5202778-5205252 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGAACCGGCGCGGCGGCCAGACCGCATTTGCGGCCATTGCGCGCAACGAGCGCGCCATCGCTGCGTTCA
TCCCCTACAGCAGCCACCTGACGGACACGACGCTGATCACCCATGGCGCGGACCTGGTCCGCACCTGGCG
CGTACAGGGGATCGCCTTCGAAAGCGCCGAGCCAGAGCTGGTTTCGCAGCGCCATGAACAGCTCAACGGC
CTGTGGCGCGCCATCTCGTGCGAGCAGGTCGCGCTTTGGATCCATTGCATCCGGCGCAAGACGCAGGCCG
GGTTGGATGCGCGGTACGAAAATCCGTTCTGCCGCGCGCTCGACGCCTCGTACAACGCCCGGCTGAACGC
GCGGCAGGCAATGACGAACGAGTTCTACCTCACCCTGGTATATCGGCCTGGCCACGCCGCGCTCGGCAAG
CGTGCGCATCACGGCCAGGCCGAGGTCCGCCGGCAACTGCTGGCCCATGTGCGACGCATGGACGAAATCG
GATCCCTGATCGAAACGACGCTGCGCAGCCATGGCGAGGACCACGAGCAGGCCATCACCGTGCTGGGCTG
CGAGACGGACAGCGCCGGCCGGCGATACTCCCGGACGCTGACCCTGCTCGAATTCCTGCTCACCGGCCAC
TGGCAGCCGGTACGTGTGCCGGCCGGGCCGCTGGACGCGTATCTCGGTTCGAGCCGGATCCTTGCCGGCG
CCGAAATGATGGAGTTGCGTTCTCCGACCTGCCGCCGCTACGCGCAGTTCATCGATTTCAAGGAATACGG
CACGCACACCGAACCAGGGATGCTGAATGCCTTGCTGTACGAGGATTACGAATATGTGATCACGCATTCG
TTCAGCGCGGTCGGCAAGCGACAGGCGCTGGCCTACCTGCAGCGGCAGCGCGCCCAGCTGGCCAACGTGC
AGGACGCCGCGTACTCGCAGATCGACGACCTCGCGCATGCCGAAGACGCCCTGGTCAATGGCGATTTCGT
GATCGGCGAGTATCACTTCTCGATGATGATCCTCGGCGCCGACCCCCGGCAACTGCGGCGCGATGTCAGT
TCGGCCATGACGCGCATCCAGGAGCGCGGCTTTCTCGCCACGCCGGTGACGTTGGCCCTGGATGCCGCCT
TCTATGCGCAATTGCCTGCCAACTGGGCATACCGGCCGCGCAAGGCCATGTTGACCAGCAGAAACTTCGC
CGGACTGTGCAGCTTTCATAATTTCTACGGCGGCAAGCGCGATGGCAACCCCTGGGGCCCGGCCCTGAGC
CTGCTGTCCACGCCTTCCGGCCAACCGTTCTACTTCAATTTCCATCACTCCGGGCTCGACGAGGATTGCC
GCGGCCAGATGATGCTGGGCAACACGCGCATCATCGGCCAGTCCGGCAGCGGCAAGACCGTGCTGCTCAA
TTTCCTGCTTTGCCAGCTGCAGAAATTCCGATCCGCGGATGCCGATGGCCTGACGACGATTTTCTTCGAC
AAGGACCGGGGCGCGGAAATCTGCATCCGCGCCCTCGATGGCCAGTACTTGCGGATACGTGACGGCGAAC
CGACCGGCTTCAACCCCTTGCAGCTGCCATGCACCGACCGCAATGTCATGTTCCTGGACTCGCTTCTGGC
GATGCTCGCGCGCGCTCATGACTCGCCGCTGACGTCGGCGCAGCACGCGACGCTGGCCACCGCTGTGCGC
ACGGTGCTGCGCATGCCGGCGTCGCTGCGGCGAATGTCCACGCTGCTGCAAAACATCACCCAGGCCACGT
CCGAGCAGCGGGAACTGGTCAGACGCCTGGGACGCTGGTGCCGCGACGACGGCGCCGGTGGCACGGGAAT
GCTGTGGTGGGTCTTCGACAATCCGAATGATTGCCTCGATTTTTCGCGGCCGGGCAACTACGGCATCGAC
GGCACCGCGTTCCTGGACAATGCCGAGACGCGCACGCCGATCTCGATGTACCTGTTGCATCGGATGAACG
AGGCCATGGATGGACGGCGCTTCGTCTATCTCATGGACGAAGCCTGGAAGTGGATCGACGACCCGGCCTT
CGCCGAGTTCGCAGGCGACCAGCAGCTGACCATACGCAAGAAGAACGGGCTGGGCGTCTTCTCCACGCAA
ATGCCAAGCAGCCTGCTCGGCGCGAGGGTCGCCGCATCGCTGGTACAGCAATGCGCAACCGAGATCTATC
TGCCCAACCCCAGGGCCGATCGCGCCGAATACCTGGATGGTTTCAAATGCACCGAAACCGAGTACCAGTT
GATCCGCTCCATGGCGGAGGACAGCCATCTTTTTCTCGTCAAACAGGGCAGGCAGGCAGTCGTCGCACAA
CTCGACCTCTCCGGCATGGATGACGAATTGGCCATCCTGTCCGGCAACGCCAGGAACCTGCGCTGTTTCG
AGCAAGCGCTGGCACTGACGCGGGAGCGCGACCCAAACGACTGGATCGCGGTATTCCATCGGCTTCGACG
CGAAGCCAGCGCCGGCCTCAGGTGA
 Primer design