SecReT4
Protein ID: 33603871
T4SS name [ID]Ptl [379]
Gene symbol-
Locus tagBB4898
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5205260..5206645 [+]
Producthypothetical protein
Component typePtlD
UniProt IDQ7WDU0
KEGG IDbbr:BB4898
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.1e-33, Aligned region: 126..356
Protein Sequence: 461 a.a.     [Download]
>gi|33603871|ref|NP_891431.1| unnamed protein product [Bordetella bronchiseptica RB50]
MAGLSRILLSCTLACLLAGQAAQASVDDPTRAGGDNRVRALRADQARRDVLLTACRDDPGHRRGEPDCVN
AERAQALQQWQAAAMTSVDAAFSDLAGALRNAAPRRMEAAIVRLTRQLQPLVYSMMTLLVLLTGYALLAR
RDRPFEWHIRHALLVAVVTSLALSPDRYLSTVVAGVQDVAGWLSGPWTAPDGAAGRGGLAQLDQFAAQAQ
AWVAQLAGQAANDANPGSAVNWLLCAMIVAASAGGWLCLAASLLIVPGLIVTLLLSLGPLFLVLLLFPAL
QRWTNAWLGALVRALVFMALGTPAVGLLSDVLAGALPAGLPQRFATDPLRSTMLAATLCATATLMLLTLV
PLASSVNAGLRRRLWPNAAHPGLAQAHRQAAARQYAPRPAAAAAAAGPHQAGTYAASATPAPARPAPSFP
AHAYRQYALGGARRPPPRVRRDDRPAPAPDRRVLPRKPNLP
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5205260-5206645 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGGCCGGCCTGTCACGAATCCTGCTGTCCTGCACGCTTGCATGCCTGCTCGCCGGGCAGGCCGCCCAGG
CCTCCGTGGACGACCCCACCCGGGCTGGCGGCGACAATCGGGTACGGGCGCTGCGCGCCGACCAGGCGCG
ACGAGACGTCCTGCTCACCGCCTGCCGCGACGACCCCGGCCACCGGCGCGGTGAGCCGGATTGCGTCAAC
GCCGAGCGCGCCCAGGCGCTGCAGCAGTGGCAGGCCGCCGCCATGACCAGCGTGGATGCCGCCTTCTCCG
ATTTGGCTGGTGCGCTGCGCAATGCGGCGCCGCGGCGGATGGAGGCCGCGATCGTACGGCTGACGCGCCA
GCTCCAGCCGCTGGTCTATTCCATGATGACGCTGCTGGTACTGTTGACTGGCTATGCACTGCTGGCGCGA
CGCGACCGCCCGTTCGAATGGCATATCCGGCACGCCCTGCTGGTTGCGGTCGTGACCTCGCTGGCACTGT
CTCCCGACCGCTACCTGTCCACCGTGGTGGCAGGCGTCCAGGACGTCGCGGGCTGGCTGAGCGGGCCCTG
GACAGCGCCGGACGGCGCGGCGGGGCGCGGCGGACTCGCGCAACTGGACCAGTTCGCCGCCCAGGCCCAG
GCCTGGGTCGCGCAACTGGCCGGCCAGGCCGCCAACGACGCCAACCCGGGCAGCGCCGTCAACTGGCTGC
TCTGCGCCATGATCGTGGCCGCCAGCGCGGGAGGCTGGCTTTGCCTGGCGGCGTCCCTGCTGATCGTGCC
GGGCCTGATAGTCACGCTGCTGCTGTCGTTGGGGCCGCTCTTTCTCGTGCTGCTGCTGTTTCCCGCGCTG
CAGCGCTGGACCAACGCCTGGCTCGGCGCGCTGGTCCGCGCGCTCGTCTTCATGGCGCTGGGCACGCCGG
CCGTCGGCCTGCTGTCCGATGTACTGGCTGGCGCCTTGCCGGCCGGCCTGCCGCAGCGGTTTGCCACCGA
CCCGCTGCGCTCGACCATGCTGGCGGCAACGCTATGCGCCACGGCGACACTCATGCTGCTGACCCTGGTC
CCGCTGGCCAGCAGCGTCAACGCGGGCCTGCGGCGCCGCCTGTGGCCTAACGCGGCCCATCCCGGGCTCG
CGCAGGCTCATCGGCAAGCCGCCGCGCGCCAGTACGCCCCCCGTCCGGCCGCGGCGGCCGCCGCCGCGGG
ACCGCACCAGGCCGGTACGTACGCAGCCTCGGCCACGCCGGCGCCGGCCCGCCCGGCCCCATCCTTCCCG
GCGCACGCCTATAGGCAGTACGCCCTGGGCGGCGCGAGAAGGCCGCCGCCCAGGGTGCGACGCGACGACC
GGCCCGCGCCGGCGCCGGACCGACGGGTTCTTCCCCGCAAACCCAACCTGCCATGA
 Primer design