SecReT4
Protein ID: 33603872
T4SS name [ID]Ptl [379]
Gene symbol-
Locus tagBB4898A
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5206642..5206827 [+]
Productsecretion system protein
Component typePtlI
UniProt IDQ7WDT9
KEGG IDbbr:BB4898A
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 61 a.a.     [Download]
>gi|33603872|ref|NP_891432.1| unnamed protein product [Bordetella bronchiseptica RB50]
MIHAHSNARLLRWAILAIAPATLGACAPNGPPGLPYPDGKPLIPINTAAPEQGSSCQTRAP
 
Nucleotide Sequence: 186 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5206642-5206827 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGATCCACGCACATTCCAACGCCAGATTATTGCGATGGGCCATCCTGGCCATCGCCCCCGCCACGCTCG
GCGCCTGCGCCCCGAACGGGCCGCCCGGCTTGCCGTATCCCGATGGCAAGCCCCTGATTCCCATCAACAC
CGCCGCCCCGGAGCAAGGATCGTCATGCCAGACCCGCGCCCCTTGA
 Primer design