SecReT4
Protein ID: 33603873
T4SS name [ID]Ptl [379]
Gene symbol-
Locus tagBB4899
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5206806..5207507 [+]
Productsecretion system protein
Component typePtlE
UniProt IDQ7WDT8
KEGG IDbbr:BB4899
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-64, Aligned region: 21..229
Protein Sequence: 233 a.a.     [Download]
>gi|33603873|ref|NP_891433.1| unnamed protein product [Bordetella bronchiseptica RB50]
MPDPRPLTPDQTHGRGHAEAAVDWEASRLYRLAQSERRAWTVAWAALAVTALSLIAIATMLPLKTTIPYL
IEVEKSSGAASVVTQFEPRDFTPDTLMNQYWLTRYVAARERYDWHTIQHDYDYVRLLSAPAVRHDYETSY
EAPDAPDRKYGAGTTLAVKILSAIDHGKGVGTVRFVRTRRDADGQGAAESSIWVATVAFAYDRPRALTQA
QRWLNPLGFAVTSYRVDAEAGQP
 
Nucleotide Sequence: 702 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5206806-5207507 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGCCAGACCCGCGCCCCTTGACGCCTGACCAGACGCATGGCCGCGGGCATGCCGAGGCCGCGGTGGACT
GGGAAGCGTCCCGCCTGTACCGGCTGGCGCAGTCGGAACGCCGTGCATGGACGGTGGCGTGGGCGGCGCT
CGCCGTGACCGCGCTGTCATTGATCGCCATCGCGACGATGCTTCCGCTCAAGACCACCATTCCTTACCTG
ATCGAGGTCGAAAAGAGCAGCGGCGCGGCCTCGGTCGTCACGCAATTCGAGCCCCGAGATTTCACCCCGG
ACACCTTGATGAACCAGTACTGGCTGACGCGCTATGTCGCGGCGCGCGAGCGCTACGATTGGCACACGAT
CCAGCACGATTACGACTACGTGCGGCTGTTGTCCGCGCCCGCCGTCAGGCACGATTACGAAACCAGCTAC
GAGGCGCCCGATGCGCCGGACCGCAAGTACGGCGCTGGCACGACCCTGGCCGTGAAAATTCTCAGCGCCA
TCGACCATGGCAAGGGCGTCGGCACGGTGCGCTTTGTCCGGACACGGCGCGACGCGGACGGGCAGGGCGC
CGCCGAATCCTCGATATGGGTAGCGACCGTGGCATTCGCCTACGATCGGCCGCGCGCGCTGACCCAGGCC
CAGCGCTGGCTCAATCCGCTGGGCTTTGCCGTCACCAGCTATCGCGTCGACGCGGAGGCTGGACAGCCAT
GA
 Primer design