SecReT4
Protein ID: 33603874
T4SS name [ID]Ptl [379]
Gene symbol-
Locus tagBB4900
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5207504..5208325 [+]
Productsecretion system protein
Component typePtlF
UniProt IDQ7WDT7
KEGG IDbbr:BB4900
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.1e-61, Aligned region: 30..255
Protein Sequence: 273 a.a.     [Download]
>gi|33603874|ref|NP_891434.1| unnamed protein product [Bordetella bronchiseptica RB50]
MMAARMMAAGLAATALSAHAFRIPTPGEQDARIQTVPYHPEEVVLVRAWNGYVTRIVFDEQEKIIDVAAG
FADGWQFSPEGNVLYIKAKSFPAQGSPAQAPEPGLWNTNLLVKTDRRLYDFDLVLASADAATPQALQRSR
MAYRLQFRYPAAPQAASRASPVGPAVPAGALNRRYAMQVGNGSDGIAPIAAYDDGRHTWLTFRPGQPFPA
VFAVAPDGTETLVNLHIDNQSLVIHRVAPVLMLRSGASVIRIVNQNGDASASPAFECHAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5207504-5208325 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGATGGCGGCACGGATGATGGCGGCCGGCCTGGCGGCCACGGCGCTTTCGGCGCATGCGTTCCGGATAC
CCACGCCAGGAGAACAGGACGCCCGCATACAGACCGTGCCGTACCACCCGGAGGAGGTGGTGCTGGTGCG
CGCCTGGAACGGCTACGTCACCCGGATCGTATTCGACGAGCAGGAGAAGATCATCGACGTCGCCGCGGGG
TTCGCCGACGGCTGGCAATTCAGCCCGGAAGGCAATGTGCTGTATATCAAGGCCAAATCCTTCCCCGCGC
AGGGCTCGCCCGCGCAGGCGCCGGAGCCGGGATTGTGGAACACCAATCTGCTCGTCAAAACCGACCGCCG
GCTCTACGACTTCGACCTGGTGCTGGCCAGCGCGGACGCGGCGACACCGCAGGCGTTGCAGCGTTCGCGC
ATGGCCTATCGCCTGCAATTCCGCTACCCGGCCGCGCCGCAGGCGGCATCCCGCGCCAGCCCCGTCGGCC
CGGCTGTTCCCGCCGGCGCATTGAACCGGCGCTACGCCATGCAGGTGGGCAACGGGTCGGACGGCATCGC
ACCCATCGCTGCGTACGACGACGGCCGGCATACCTGGCTCACGTTCAGACCGGGTCAGCCGTTTCCGGCC
GTATTCGCGGTAGCGCCGGACGGAACGGAAACCCTGGTCAATCTGCATATCGACAACCAATCACTGGTCA
TACACCGGGTAGCGCCGGTCCTGATGCTGCGGTCCGGCGCCAGCGTCATCCGGATCGTCAACCAGAACGG
CGATGCGTCCGCGTCCCCAGCCTTCGAATGCCATGCTGAACCGGCCCTCTAG
 Primer design