SecReT4
Protein ID: 33603875
T4SS name [ID]Ptl [379]
Gene symbol-
Locus tagBB4901
StrainBordetella bronchiseptica RB50
Repliconchromosome [GenBank: NC_002927] [Browse all T4SS(s) in this replicon]
Location [Strand]5208306..5209430 [+]
Productsecretion system protein
Component typePtlG
UniProt IDQ7WDT6
KEGG IDbbr:BB4901
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.6e-55, Aligned region: 189..366
Protein Sequence: 374 a.a.     [Download]
>gi|33603875|ref|NP_891435.1| unnamed protein product [Bordetella bronchiseptica RB50]
MLNRPSSPDGGEAHAWPPDPEIPVFANAEHAHRRPLRWMFALVAVALSCLLATGIWRSRAAPPHAATQTV
APAGQALPPGRIFTVHPREPEPAPLPDMPAAPDPILPQPRPAPPVPPPPIRAPYDYDEPAPRRDSAALKS
GPAMMVATAARLGQTERAGMADDGVSADAATLIGRNVSRATRSGDRDYRLLPGTFIDCILQTRIVTNVPG
LTTCIVSRDVYSASGKRVLVPRGTTVVGEYRADLAQGSQRIYVAWSRLFMPSGLTIELASPAVDGTGAAG
LPGVVDDKFAQRFGGALLLSVLGDATSYMLARATDARHGVNVNLTAAGTMNSLAASALNNTINIPPTLYK
NHGDQIGILVARPLDFSILRGTNE
 
Nucleotide Sequence: 1125 bp     [Download]
>gi|33598993|ref|NC_002927.3|:5208306-5209430 Bordetella bronchiseptica RB50 chromosome, complete genome
ATGCTGAACCGGCCCTCTAGTCCCGATGGCGGCGAAGCGCACGCTTGGCCGCCGGACCCCGAAATCCCTG
TTTTCGCCAATGCCGAGCATGCGCATCGGCGTCCGCTGCGCTGGATGTTCGCCCTTGTCGCCGTGGCCCT
GTCATGCCTGCTGGCAACGGGGATATGGCGCAGCCGCGCCGCGCCGCCGCACGCCGCGACGCAGACCGTC
GCGCCGGCGGGGCAAGCCCTGCCGCCGGGGCGCATATTCACGGTCCACCCACGCGAACCCGAACCGGCGC
CGCTTCCGGACATGCCGGCGGCTCCCGACCCGATCCTGCCGCAGCCGCGGCCGGCGCCACCCGTCCCGCC
CCCGCCAATCCGCGCGCCGTACGACTACGATGAACCGGCGCCCCGGCGCGACAGCGCGGCGCTCAAGTCC
GGCCCGGCCATGATGGTCGCCACGGCCGCGCGCCTTGGACAAACCGAGCGGGCGGGCATGGCGGACGACG
GCGTGTCCGCGGATGCGGCCACCCTCATCGGCAGGAACGTCAGCCGCGCAACCCGCTCCGGGGACCGCGA
TTACCGGCTGCTGCCCGGCACGTTTATCGATTGCATCCTGCAGACCCGGATCGTCACCAACGTCCCGGGG
CTGACGACCTGCATCGTATCGCGGGATGTCTACAGCGCCAGCGGCAAGCGCGTCCTGGTGCCGCGTGGCA
CGACAGTGGTGGGCGAATACCGCGCCGACCTGGCGCAGGGCTCGCAACGCATCTACGTCGCATGGAGCCG
GCTTTTCATGCCGTCCGGGCTCACGATAGAGCTGGCATCGCCGGCCGTGGACGGAACCGGCGCCGCGGGG
CTGCCCGGCGTGGTGGACGACAAATTCGCGCAGCGTTTCGGCGGCGCCCTGCTGCTGAGCGTATTGGGCG
ATGCCACCTCGTACATGCTGGCGCGCGCCACCGATGCGCGCCACGGCGTGAACGTGAACCTTACCGCCGC
GGGAACGATGAATTCGCTGGCCGCCAGCGCCCTGAACAACACGATCAACATCCCGCCCACGCTCTACAAG
AACCACGGCGACCAGATCGGCATCCTGGTCGCCCGTCCATTGGACTTCTCCATACTCAGGGGGACGAATG
AATGA
 Primer design