SecReT4
Protein ID: 336053209
T4SS name [ID]Trw [139]
Gene symboltraJ
Locus tagpN3_016
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]10946..12475 [+]
Productconjugal transfer protein
Component typeTrwB
UniProt IDF6IB81
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.4e-116, Aligned region: 112..490
TraG-D_C [PF12696], Evalue: 1.5e-19, Aligned region: 350..471
T4SS-DNA_transf [PF02534], Evalue: 7.4e-10, Aligned region: 313..472
DUF87 [PF01935], Evalue: 1.5e-05, Aligned region: 116..170
Protein Sequence: 509 a.a.     [Download]
>gi|336053209|ref|YP_004558186.1| conjugal transfer protein [Escherichia coli]
MDDRERGLAFLFAITLPPVMVWFLVAKFTYGIDPSTAKYLIPYLVKNTFSLWPLWSALIAGWFIGVGGLI
AFIIYDKSRVFKGERFKKIYRGTELVSARTLADKTRERGVNQLTVANIPIPTYAENLHFSIAGTTGTGKT
TIFNELLFKSIIRGGKNIALDPNGGFLKNFYRPGDVILNAYDKRTEGWVFFNEIRRSYDYERLVNSIVQE
SPDMATEEWFGYGRLIFSEVSKKLHSLYSTVTMEEVIHWACNVDQKKLKEFLMGTPAEAIFSGSEKAVGS
ARFVLSKNLAPHLKMPEGNFSLRDWLDDGKPGTLFITWQEEMKRSLNPLISCWLDSIFSIVLGMGEKESR
INVFIDELESLQFLPNLNDALTKGRKSGLCVYAGYQTYSQLVKVYGRDMAQTILANMRSNIVLGGSRLGD
ETLDQMSRSLGEIEGEVERKESDPQKPWIVRKRRDVKVVRAVTPTEISMLPNLTGYLALPGDMPVAKFKA
KHVKYHRKNPVPGIELRDI
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|336053193|ref|NC_015599.1|:10946-12475 Escherichia coli IncN plasmid N3, complete sequence
ATGGACGATAGAGAAAGAGGCTTAGCATTTTTATTTGCAATTACTTTGCCTCCAGTGATGGTATGGTTTC
TAGTTGCAAAATTTACCTACGGTATTGATCCATCCACGGCTAAATACCTGATTCCGTATCTGGTTAAGAA
TACTTTTTCGCTATGGCCTTTATGGTCAGCTTTAATTGCTGGCTGGTTTATTGGTGTTGGCGGTCTGATC
GCTTTTATCATTTATGATAAATCACGCGTGTTTAAAGGCGAAAGATTCAAAAAGATTTATCGTGGTACAG
AGCTTGTTAGCGCCAGAACACTCGCTGATAAAACACGCGAAAGAGGTGTCAACCAGTTAACCGTGGCTAA
TATCCCCATACCTACATACGCTGAGAACTTGCATTTTTCGATTGCCGGTACAACCGGTACTGGTAAAACC
ACAATTTTCAATGAACTGTTATTTAAGAGCATCATTAGAGGCGGCAAAAATATTGCTTTAGATCCAAATG
GGGGGTTCTTAAAGAATTTCTATCGTCCCGGCGATGTTATTTTAAACGCCTATGATAAACGCACTGAAGG
CTGGGTGTTTTTCAATGAAATTCGCCGTTCATATGATTACGAGCGCTTAGTGAACTCTATTGTTCAGGAA
AGCCCTGATATGGCTACTGAAGAATGGTTCGGCTATGGCCGTCTTATTTTTAGTGAAGTTTCGAAAAAAC
TTCACAGCCTATACAGCACAGTAACTATGGAAGAAGTTATTCACTGGGCCTGTAACGTTGACCAGAAAAA
ATTAAAAGAATTTTTAATGGGGACGCCTGCCGAAGCTATTTTTTCCGGGTCTGAAAAAGCAGTTGGAAGC
GCGCGATTTGTTCTCAGTAAGAATCTTGCCCCACATTTGAAAATGCCGGAAGGTAATTTTTCCCTGCGTG
ACTGGCTTGATGATGGAAAGCCGGGAACCTTGTTTATCACCTGGCAGGAAGAAATGAAAAGGTCACTTAA
TCCGCTAATTTCCTGCTGGCTGGATTCGATTTTTTCTATCGTGCTGGGTATGGGTGAAAAAGAAAGCCGC
ATTAATGTATTTATTGACGAGCTGGAATCACTCCAGTTTCTGCCAAACCTCAACGATGCACTGACCAAAG
GGCGTAAAAGCGGTCTGTGTGTTTATGCTGGCTATCAAACCTATTCTCAGCTGGTTAAGGTTTATGGTCG
GGATATGGCTCAGACAATTCTGGCTAACATGCGTTCTAACATCGTGCTGGGCGGCAGCCGTCTCGGTGAT
GAAACGTTGGATCAAATGTCGCGCTCACTCGGTGAGATAGAAGGCGAAGTTGAGCGTAAAGAATCCGATC
CTCAGAAGCCCTGGATTGTCCGTAAACGCCGCGACGTTAAAGTTGTTCGTGCCGTAACGCCTACCGAAAT
ATCAATGTTGCCAAACCTCACCGGCTATCTGGCGTTGCCTGGTGATATGCCCGTCGCTAAGTTCAAGGCT
AAACACGTTAAATACCATCGCAAAAACCCTGTTCCTGGCATTGAACTGAGGGATATCTGA
 Primer design