SecReT4
Protein ID: 336053213
T4SS name [ID]Trw [139]
Gene symboltraG
Locus tagpN3_020
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]17050..18045 [-]
Productconjugal transfer protein
Component typeTrwD
UniProt IDQ17U13
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.3e-50, Aligned region: 10..311
AAA_22 [PF13401], Evalue: 2.9e-05, Aligned region: 156..191
Protein Sequence: 331 a.a.     [Download]
>gi|336053213|ref|YP_004558190.1| conjugal transfer protein [Escherichia coli]
MTDAAFYQLGPLREYLEDPTVFEIRINCFQEVICDTFSGRRVVQNAAITADFIRNLAKSLVSSNKLTMQA
INDVILPGGIRGVICLPPAVIDGTTAVAFRKDLAADKNLEQLTSEGIFSDCRKITGSKQSLTDDDFFLKE
LHSSEKWPAFLQTAVEKKRTIVICGETGSGKTVLTRALLKSLHKDERVIILEDVHEVTVDHVVEAVYMMY
GDAGKIGRVSATDALRACMRLTPGRIIMTELRDDAAWDYLKALNTGHPGGVMSTHANSARDAFNRIGLLI
KATPIGRMLDMSDIMRMLYSTIDVVVHMEKRKIKEIYFDPEYKMQCVNGSL
 
Nucleotide Sequence: 996 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c18045-17050 Escherichia coli IncN plasmid N3, complete sequence
ATGACTGATGCAGCTTTCTATCAACTTGGCCCACTGCGCGAGTATTTAGAAGATCCTACTGTTTTTGAAA
TTCGCATTAACTGCTTTCAGGAAGTTATCTGTGATACGTTCAGCGGCCGCAGGGTTGTGCAGAACGCGGC
AATTACGGCAGATTTTATTAGGAACCTTGCTAAATCGTTGGTGAGCAGCAACAAGCTGACCATGCAGGCC
ATTAATGACGTGATCCTGCCTGGCGGGATCAGGGGCGTTATCTGTCTGCCCCCTGCGGTGATTGACGGTA
CAACGGCCGTAGCGTTTCGTAAGGATTTGGCGGCCGATAAAAATCTGGAGCAGCTGACCAGCGAGGGGAT
TTTCAGTGACTGCCGGAAGATTACCGGCAGCAAGCAAAGCCTAACGGATGATGATTTTTTCCTTAAAGAG
CTGCACAGCAGCGAAAAATGGCCCGCATTCCTGCAAACCGCCGTTGAGAAGAAACGCACTATCGTGATCT
GCGGTGAAACCGGGTCGGGGAAAACGGTACTCACGCGCGCGCTGTTAAAATCGCTACATAAAGACGAGCG
TGTAATTATTTTAGAGGACGTTCACGAAGTCACGGTCGATCACGTTGTAGAAGCCGTTTATATGATGTAC
GGCGATGCAGGAAAGATCGGCCGCGTCAGCGCCACTGATGCCCTGCGAGCCTGTATGCGTCTGACACCGG
GCCGTATCATCATGACTGAGCTTAGGGATGATGCTGCGTGGGATTATCTTAAAGCACTTAATACCGGCCA
TCCAGGCGGTGTTATGTCAACGCACGCTAACTCTGCGCGCGATGCCTTTAACCGTATTGGGCTGCTTATC
AAGGCGACCCCTATCGGCCGTATGCTCGATATGAGCGATATTATGCGAATGCTCTACTCCACCATTGACG
TTGTGGTGCATATGGAAAAGCGGAAAATCAAAGAAATTTATTTTGACCCTGAATATAAAATGCAGTGTGT
GAACGGGAGCCTGTAA
 Primer design