SecReT4
Protein ID: 336053216
T4SS name [ID]Trw [139]
Gene symboltraE
Locus tagpN3_023
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]20142..20840 [-]
Productconjugal transfer protein
Component typeTrwG
UniProt IDQ17U16
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9e-53, Aligned region: 24..230
Protein Sequence: 232 a.a.     [Download]
>gi|336053216|ref|YP_004558193.1| conjugal transfer protein [Escherichia coli]
MKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHKYSQPIPA
HLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSK
FKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNA
EQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c20840-20142 Escherichia coli IncN plasmid N3, complete sequence
ATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGTTCAACGAAAGCCGTAAAGGGC
TTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTGGATGGTTGCCACCGGTTCAGC
GGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTGGTGCATAAGTACAGCCAGCCAATCCCCGCA
CATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTT
ATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTC
AGTTCAGGTCGACTATACGGCCGTTGGCTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAG
TTCAAGGGCCGCAACGGTCTTGATAAGGTTCTGGGCGACAGTGAAACGACCCGCGTGAAGATTAACTCTG
TGATCCTCGATAAACCGCACGGCGTAGCAACGATACGCTTTACTACGGTTCGCCGCGTGCGCAGCAATCC
CGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCGATGAATGCT
GAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAACCCTGAAGTTAACTGA
 Primer design