SecReT4
Protein ID: 336053217
T4SS name [ID]Trw [139]
Gene symboltraN
Locus tagpN3_024
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]20830..20976 [-]
Productconjugal transfer protein
Component typeTrwH
UniProt IDQ17U17
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|336053217|ref|YP_004558194.1| conjugal transfer protein [Escherichia coli]
MRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGANES
 
Nucleotide Sequence: 147 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c20976-20830 Escherichia coli IncN plasmid N3, complete sequence
ATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGCATAAACCGCCACCGG
AGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCAAGGTGGTGCAAATGA
AAGCTAA
 Primer design