SecReT4
Protein ID: 336053218
T4SS name [ID]Trw [139]
Gene symboltraD
Locus tagpN3_025
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]21059..22099 [-]
Productconjugal transfer protein
Component typeTrwI
UniProt IDD9Z5P3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.4e-50, Aligned region: 40..268
Protein Sequence: 346 a.a.     [Download]
>gi|336053218|ref|YP_004558195.1| conjugal transfer protein [Escherichia coli]
MAFTLVADIFAKVDGAITSMVSANVATIISDVTPLIATCLTIKLMVQGMYSAFNPGAGDSLSSLIKEYLS
IALILSFATAGGWYQQELVNVALHLPDDFAGILSAPNKVGASGVPAIIDSGIEKGIKIVNTAWEAADVFS
SSGLAAYAIGGIMMIATVVLGGLGAGFVIMAKILLAVTLCFGPIAIFCLLWGATKNIFARWLASVINYGL
VVVILALVFGFIMQMFDNLLSSMNSDAAYSSITGSISALLLTVISVFVLFQIPQIAASWGSGISAGVADA
ARSTGSSMQALGNMGSHGMFGGNAFRGGNSGGGQQSAGGGSGSNSGGSSGSNLSGKARGSRGKKAA
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c22099-21059 Escherichia coli IncN plasmid N3, complete sequence
ATGGCATTCACCCTAGTCGCAGACATTTTCGCAAAAGTAGACGGGGCGATTACGTCAATGGTGAGCGCCA
ATGTTGCCACCATTATCTCTGATGTAACGCCTCTGATTGCCACCTGTCTGACAATCAAGCTGATGGTTCA
GGGGATGTACTCAGCGTTTAATCCGGGGGCGGGCGACAGCCTGAGTTCGCTGATTAAAGAGTATCTTTCC
ATAGCCCTTATCCTGAGCTTTGCAACGGCGGGCGGCTGGTATCAACAGGAACTGGTCAACGTGGCGCTTC
ACCTGCCGGATGATTTTGCCGGGATACTGTCTGCCCCTAATAAAGTCGGTGCAAGTGGCGTACCGGCGAT
TATTGATAGCGGTATTGAAAAAGGTATCAAGATCGTCAACACCGCATGGGAAGCCGCAGACGTGTTTTCA
TCGAGCGGCCTGGCCGCGTATGCCATTGGCGGCATTATGATGATTGCTACCGTTGTGCTGGGCGGCCTCG
GTGCGGGCTTTGTGATCATGGCTAAGATCCTTCTGGCCGTTACGCTTTGTTTTGGCCCGATTGCAATCTT
CTGCCTGCTGTGGGGAGCGACAAAAAACATCTTTGCTCGCTGGCTGGCGTCGGTCATTAACTATGGCCTT
GTCGTCGTCATTCTTGCGCTCGTGTTTGGTTTCATCATGCAGATGTTCGACAACCTCCTGTCCTCGATGA
ACTCTGATGCCGCTTACTCATCAATCACTGGTTCTATCTCCGCCTTATTACTGACGGTCATTTCCGTTTT
CGTTCTGTTCCAGATTCCGCAAATTGCCGCCAGCTGGGGTAGCGGTATCAGCGCCGGAGTTGCTGACGCC
GCACGCTCTACGGGTTCTTCCATGCAGGCGCTTGGCAATATGGGCAGCCACGGCATGTTTGGCGGTAATG
CGTTCAGAGGCGGTAACAGTGGCGGCGGCCAGCAATCGGCAGGTGGAGGAAGTGGCAGCAACAGCGGAGG
AAGCAGTGGTTCTAATTTAAGTGGTAAGGCAAGGGGCAGTCGCGGGAAGAAGGCTGCATAA
 Primer design