SecReT4
Protein ID: 336053220
T4SS name [ID]Trw [139]
Gene symboltraC
Locus tagpN3_027
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]22350..23063 [-]
Productconjugal transfer protein
Component typeTrwJ
UniProt IDF6IB92
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 9.1e-50, Aligned region: 25..216
CENP-Q [PF13094], Evalue: 3.3e-06, Aligned region: 33..137
Protein Sequence: 237 a.a.     [Download]
>gi|336053220|ref|YP_004558197.1| conjugal transfer protein [Escherichia coli]
MKKTLTAVLLTTGLILGGAQSASAGIIVTNPTELAKQVEQLQQMAQQLEQLKSQLQTQKNMYESMAKTTN
LGDLLGTSTSTLANNLPDNWKEIYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAITYMNKKLAEKGA
YDRVMAEKAYNNQMQELTDMQELTEQIKTTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKERATHNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c23063-22350 Escherichia coli IncN plasmid N3, complete sequence
ATGAAAAAAACACTGACGGCAGTATTGCTGACCACCGGCCTGATTCTGGGAGGCGCGCAAAGCGCTTCCG
CAGGCATCATCGTGACCAACCCTACTGAGCTGGCTAAACAGGTCGAGCAGCTTCAGCAAATGGCGCAGCA
GCTGGAGCAGCTTAAAAGCCAGCTGCAAACGCAGAAAAATATGTATGAGTCGATGGCAAAGACAACCAAC
CTGGGCGATCTGCTGGGGACGTCTACCAGCACGCTGGCAAATAATTTGCCGGACAACTGGAAGGAGATCT
ACAGCGACGCCATGAACTCCAGTTCTTCCGTCACGCCTTCAGTTAACAGCATGATGGGCCAGTTTAATGC
GGAAGTTGACGACATGACGCCCAGCGAAGCAATTACCTACATGAACAAAAAGCTGGCTGAAAAAGGCGCT
TATGACCGCGTTATGGCAGAAAAAGCCTACAACAACCAGATGCAGGAACTAACCGATATGCAGGAGCTGA
CGGAGCAGATTAAAACGACTCCAGACCTGAAATCGATTGCTGACTTACAGGCCCGTATCCAGACGTCACA
GGGTGCTATTCAGGGTGAGCAGGCGAAGCTGAATCTGATGAACATGTTGCAGCAGTCACAGGACAAGCTA
TTACGTGCGCAGAAAGAACGTGCCACCCACAATTTTGTTTTTGGAACCGGCGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design