SecReT4
Protein ID: 336053221
T4SS name [ID]Trw [139]
Gene symboltraB
Locus tagpN3_028
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]23081..25681 [-]
Productconjugal transfer protein
Component typeTrwK
UniProt IDF6IB93
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 7.1e-60, Aligned region: 232..429
AAA_10 [PF12846], Evalue: 1e-34, Aligned region: 492..775
Protein Sequence: 866 a.a.     [Download]
>gi|336053221|ref|YP_004558198.1| conjugal transfer protein [Escherichia coli]
MRAATATKPKKIDAYRKEPSVNKKYLPYSYHLNDYVISMENGDLMAFFKLDGRTHDCASDRELVTWHKDL
NTLVKSFGTDHVELWTHEYHHEAKEYPDGEYDHFFPAYVDQYNRKLHGDSKQLINDLYLTVIYKQVGDKT
QKFLAKFEKPTRDEIQQMQNEALEGLEDISEQILEAMKPYGIQQLGIYYRDKRGVEIPAPDKKEREELAE
VDESDIFDEAIVIERNEPEPSQAHAYSKALEFLYFLANMEWAIVPVCRDRIREYIMDNRPVSSLWGDVVQ
IRTVDHNFYTTGIEFREYEEDTEPGQLNMLKEADFEYLLTQSFSCLSESSAKTFLTHQEKSLQETRDRAQ
SQLAQLGTALDMLTSREFVMGYHHGTVHVWDNDQNAVQRKARRVKVMLTGCGVVGGTISLASEAAYYARL
PGNQKWAPRPVPINSWNFLHFSPFHNFMRGKPDNNPWGPALTMFRTISGTPLYFNFHVTPLEELSYGKRP
LGHALITGMSGEGKTTLLNFLLAQSMKYNPRLFVYDRDRGMEPFIRSVGGYYKVLQQGMPSGFAPLQIEP
TKRNIALIKNLFRICVETTNNGPISATMATELAEGVDAVMGEGSLIPREARTVTILDGYVNEVVENGVSL
KGLLREWTREGQYGWLFDNDKDSLDLSANDIFGFDLSEFIAAKEEVSSPARTPLMMYLLYRVRDSIDGKR
RVIQCFDEFHAYLDDPVIEREVKRGIKTDRKKDAIYVFATQEPNDALSSRIGRTIMSQTVTKICLRDPEA
IREDYAFLTDAEYDALMSITEHSRQFLVKQGQQSAIASFNLYPRNSDDIDADIKTMDNVLSVLSGEPQNA
EIAHELVERLGNDPEVWLKEYWRLTA
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c25681-23081 Escherichia coli IncN plasmid N3, complete sequence
ATGAGAGCTGCCACCGCTACGAAGCCAAAAAAAATTGATGCCTACCGTAAGGAGCCATCAGTAAATAAAA
AGTATTTGCCCTATTCTTATCACCTCAATGATTACGTGATTTCGATGGAAAACGGCGATCTGATGGCTTT
TTTCAAGCTGGATGGCCGCACACATGACTGCGCATCAGATCGGGAACTGGTCACCTGGCATAAAGACCTT
AATACGCTGGTCAAGAGCTTCGGAACAGACCATGTAGAGCTGTGGACGCATGAATATCACCATGAGGCTA
AAGAGTACCCGGATGGTGAGTATGACCATTTTTTCCCTGCTTATGTTGATCAATATAACCGTAAGCTGCA
CGGTGATTCCAAGCAGCTGATTAATGACCTTTATCTGACCGTTATTTACAAACAGGTAGGGGATAAAACA
CAGAAGTTTCTGGCGAAATTTGAAAAGCCGACTCGTGACGAAATTCAGCAAATGCAGAATGAGGCGCTTG
AAGGTCTGGAAGATATTTCTGAACAAATCCTGGAAGCAATGAAGCCGTATGGCATTCAGCAGTTGGGTAT
CTATTATCGTGACAAACGCGGTGTTGAAATTCCTGCGCCTGATAAAAAAGAACGTGAAGAACTTGCTGAA
GTCGATGAATCAGACATTTTTGACGAAGCCATTGTTATCGAACGCAACGAGCCTGAACCTTCGCAGGCTC
ACGCTTATTCAAAAGCGCTGGAGTTCCTTTATTTCCTCGCAAATATGGAATGGGCCATCGTGCCTGTTTG
CCGTGATCGTATCCGTGAGTACATCATGGACAACCGCCCTGTTAGCTCCCTGTGGGGGGATGTTGTCCAG
ATCAGAACGGTAGATCACAACTTCTATACCACCGGCATTGAATTTCGTGAATACGAAGAAGATACAGAGC
CAGGCCAGCTTAACATGCTTAAAGAAGCCGATTTTGAATACCTTCTGACGCAGAGTTTTTCTTGCCTCTC
TGAATCTTCAGCTAAAACGTTTCTGACGCATCAGGAAAAATCTTTGCAGGAAACGCGCGACCGTGCGCAA
AGCCAGCTGGCACAGCTTGGTACTGCGCTCGATATGCTGACGTCCAGAGAGTTCGTGATGGGCTACCATC
ATGGAACCGTGCATGTCTGGGATAATGACCAAAACGCGGTACAGCGCAAAGCGCGTCGTGTGAAGGTTAT
GCTAACCGGCTGTGGCGTGGTTGGCGGGACTATCAGCCTGGCCTCTGAGGCTGCATATTATGCGAGACTG
CCTGGCAACCAGAAATGGGCGCCGCGCCCGGTTCCGATAAACTCATGGAACTTCCTGCACTTCAGCCCGT
TCCACAATTTTATGCGTGGCAAGCCTGACAATAACCCGTGGGGGCCAGCGCTGACCATGTTCCGCACGAT
CAGCGGTACGCCACTCTATTTTAATTTCCATGTGACCCCGCTTGAAGAACTTTCCTACGGTAAACGCCCG
CTGGGCCATGCGTTAATAACGGGTATGTCGGGGGAAGGTAAAACCACGCTGCTTAACTTCCTGCTGGCGC
AGTCAATGAAGTACAACCCGCGGCTTTTTGTTTATGACCGTGACCGCGGTATGGAGCCGTTCATTCGAAG
CGTTGGTGGCTACTATAAAGTTCTGCAACAGGGTATGCCGTCCGGGTTTGCCCCGCTTCAGATTGAACCG
ACCAAACGCAATATTGCCCTCATTAAAAACCTGTTCCGCATTTGTGTGGAAACCACCAATAACGGGCCTA
TCAGCGCAACGATGGCTACCGAACTGGCTGAAGGCGTTGATGCGGTTATGGGGGAAGGCTCACTTATTCC
ACGCGAGGCGCGCACCGTTACTATCCTGGACGGGTACGTGAATGAAGTTGTGGAAAATGGCGTATCACTG
AAAGGGCTGCTGCGCGAATGGACGCGCGAAGGCCAGTATGGCTGGCTGTTTGACAATGATAAAGACAGCC
TGGATCTCAGCGCGAATGATATTTTTGGCTTCGATTTATCCGAGTTTATCGCAGCCAAAGAGGAAGTATC
CAGCCCGGCCCGTACTCCGCTCATGATGTACCTTCTGTACCGGGTACGTGACTCCATCGACGGCAAACGC
CGCGTCATTCAGTGCTTTGACGAGTTCCACGCCTACCTTGACGATCCGGTTATCGAGCGTGAAGTTAAGC
GTGGTATCAAAACTGACCGTAAGAAAGACGCTATCTATGTGTTTGCCACGCAGGAGCCGAACGATGCGCT
GTCCAGCCGTATTGGCCGCACGATCATGTCGCAGACCGTCACAAAAATCTGCCTGCGCGATCCGGAAGCT
ATCCGAGAGGATTATGCCTTCCTTACTGATGCTGAATACGACGCGCTGATGTCGATTACCGAACACTCCA
GACAGTTCCTGGTTAAACAAGGGCAACAGTCTGCGATTGCTTCTTTCAATCTCTACCCTCGCAACAGCGA
CGATATTGATGCAGATATTAAGACAATGGACAACGTTCTTAGCGTGTTGTCCGGTGAACCACAAAACGCC
GAAATTGCGCATGAGCTGGTTGAACGGCTCGGTAATGACCCTGAAGTATGGCTCAAAGAATACTGGCGCC
TGACGGCTTAA
 Primer design