SecReT4
Protein ID: 336053222
T4SS name [ID]Trw [139]
Gene symboltraA
Locus tagpN3_029
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]25681..25998 [-]
Productconjugal transfer protein
Component typeTrwM
UniProt IDQ0ZKR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.6e-23, Aligned region: 1..79
Protein Sequence: 105 a.a.     [Download]
>gi|336053222|ref|YP_004558199.1| conjugal transfer protein [Escherichia coli]
MFVDGKRPLFKGATRLPRALGVPRNVAMMIFMISASLFMIIHMWAILVFVFLWIPSAALTKYDDRMFRIM
GLWLKTKFSNWFDSPFKQWGGSSYSSVDYKRKGLK
 
Nucleotide Sequence: 318 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c25998-25681 Escherichia coli IncN plasmid N3, complete sequence
ATGTTCGTTGACGGGAAAAGACCGCTTTTCAAAGGTGCGACTCGCTTACCTCGCGCGCTGGGTGTACCAC
GTAATGTAGCTATGATGATATTCATGATTTCTGCCTCGCTTTTTATGATTATTCATATGTGGGCGATTCT
GGTGTTCGTCTTTTTGTGGATTCCTTCAGCTGCATTAACAAAATATGACGACCGCATGTTTCGAATTATG
GGCCTGTGGTTGAAAACCAAATTCAGTAATTGGTTTGATTCTCCGTTTAAGCAGTGGGGAGGATCGTCTT
ATTCCTCTGTTGACTACAAACGTAAGGGTTTAAAATAA
 Primer design