SecReT4
Protein ID: 336053223
T4SS name [ID]Trw [139]
Gene symboltraM
Locus tagpN3_030
StrainEscherichia coli plasmid IncN plasmid N3 (NC_015599)
Repliconplasmid IncN plasmid N3 [GenBank: NC_015599] [Browse all T4SS(s) in this replicon]
Location [Strand]26048..26341 [-]
Productconjugal transfer protein
Component typeTrwL
UniProt IDD9Z5N8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|336053223|ref|YP_004558200.1| conjugal transfer protein [Escherichia coli]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASFLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|336053193|ref|NC_015599.1|:c26341-26048 Escherichia coli IncN plasmid N3, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCGCTGATTGGTATTGGTTCTGCATCATTTCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design