SecReT4
Protein ID: 336064922
T4SS name [ID]Tra_Tn [645]
Gene symbol-
Locus tagSGPB_1671
StrainStreptococcus pasteurianus ATCC 43144
Repliconchromosome [GenBank: NC_015600] [Browse all T4SS(s) in this replicon]
Location [Strand]1731310..1733487 [+]
ProductTn916 ORF15 signal peptide containing protein
Component typeOrf15_Tn
UniProt IDF5X336
KEGG IDstb:SGPB_1671
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 725 a.a.     [Download]
>gi|336064922|ref|YP_004559781.1| Tn916 ORF15 signal peptide containing protein [Streptococcus pasteurianus ATCC 43144]
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYSRYPLENYQLD
FYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQEAYSLDFISATADSIGKNMQT
LAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKK
INDFSSDISNASLSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLL
STSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFII
YAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQS
GSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKV
KENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEMEQVKQKKQPASSVHERPTTRQEQYHDEQTS
KQSNIQTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQ
RVPLQNTRSRPPIKTATIKKVGKKP
 
Nucleotide Sequence: 2178 bp     [Download]
>gi|336063372|ref|NC_015600.1|:1731310-1733487 Streptococcus pasteurianus ATCC 43144, complete genome
GTGAAACCATCAATAGTAAACAGAATAAAATCAAACTGGACGCTGAAACGTCTAGGTAAAGTGGCAATGA
CAGTGGCTTTCACACTTGTGATTGCCATTTTTCTTTTAGCCATGCTGGGAACGGTGGTTCAAGCTGCGGG
CTTGGTAGATGATACGGTCAATGTGGCAAATGAATACAGCCGATACCCACTTGAAAACTATCAACTGGAT
TTTTATGTGGATAATAGCTGGGGCTGGCTTCCGTGGAACTGGTCGGACGGGATTGGAAAACAGGTCATGT
ATGGACTATATGCCATTACCAATTTTATTTGGACAATCAGTTTGTATGTTTCCAATGCGACAGGTTACTT
AGTACAGGAAGCCTATTCCTTAGACTTCATTTCCGCTACAGCAGATTCCATTGGTAAGAATATGCAGACC
TTAGCTGGTGTGAGTGCAAACGGATTTTCAACAGAGGGTTTCTATGTTGGATTCCTCTTACTCTTGATTT
TGGTTCTTGGGGTTTATGTTGCCTATACGGGACTGATAAAGAGAGAAACCACAAAGGCAATTCATGCCAT
TATGAATTTTGTGCTGGTGTTTATCCTATCGGCTTCCTTTATTGCCTACGCTCCCGACTACATTAAAAAA
ATCAATGACTTTTCATCAGACATCAGTAATGCCAGTTTATCACTTGGCACGAAGATTGTCATGCCCCATT
CCGATAGTCAAGGCAAGGACAGCGTGGACTTAATCAGAGATAGCCTGTTTTCCATACAGGTTCAGCAACC
GTGGCTACTGCTTCAATACAACAGTTCAGACATTGAAAGTATCGGTATTGACCGTGTGGAAAGCCTGCTC
TCCACCAGCCCAGATTCCAACAATGGCGAAGACAGAGAAAAAATTGTTGCGGAAGAAATTGAAGACAGAA
GCAATACCAATCTAACCATTACAAAGACCATTAACCGTTTAGGTACAGTCTTCTTCCTATTTGTCTTCAA
TATTGGGATTTCCATATTTGTATTCCTATTAACAGGAATCATGATTTTCTCGCAGGTACTTTTTATCATC
TATGCTATGTTTCTGCCTGTGAGCTTTATTTTAAGCATGATTCCATCATTTGATGGTATGTCAAAACGAG
CCATAACAAAGCTCTTTAATACCATTTTGACACGAGCTGGAATCACATTGATTATTACGACAGCATTTAG
TATTTCAACCATGCTCTATACCTTATCGGCTGGTTATCCGTTCTTTTTGATTGCTTTTCTACAGATTGTG
ACCTTTGCAGGAATCTACTTCAAGCTGGGCGATTTAATGAGTATGTTTTCTCTACAGAGTAACGATTCTC
AAAGTGTGGGAAGTCGTGTGATGAGAAAACCTCGTATGCTTATGCACGCTCACATGCACCGTCTACAGCG
GAAACTTGGACGTTCCATGACTACTCTAGGGGCTGGGTCTGCCATTGTTACAGGTAAAAAAGGACAGTCG
GGTTCGGGGAGTTCTGCAAGGACACAAGCAGATCACTCCCGACCAGACGGAAAGGAAAAATCAACACTTG
GAAAACGTATCGGTCAAACCATCGGTACAGTAGCTGATACCAAAGACAGAATGGTAGACACTGCTAGTGG
TTTGAAAGAACAGGTTAAAGATTTGCCGACCAATGCAAGATATGCAGTATATCAAGGAAAATCCAAAGTA
AAAGAGAATGTCCGTGATTTAACCAGTAGTATTTCTCAAACCAAAGCGGACAGAGCCAGTGGACGCAAGG
AACAGCAGGAACAAAGGCGAAAAACCATTGCGAAGCGTCGCTCTGAAATGGAACAGGTCAAACAGAAAAA
ACAGCCTGCTTCTTCTGTTCATGAAAGACCGACTACAAGACAAGAACAATATCATGATGAACAGACCTCA
AAACAGTCTAATATTCAGACTTCATATAAGGAATCTCAACAAGCCAAACAAGAGCGTCCAGCAGTTAAGT
CCGATTTTTCAAGTCCAAAAGTGGAACGCCAAGGCAATACCGTTCAAGAAAAAACCGTTCAAAAGCCAGC
AACTTCAACCACTACAGCAGATAGAACTTCACAACGTCCAATCACAAAAGAACGTCCGTCTACTGTTCAA
AGAGTACCACTACAAAATACAAGAAGTAGACCACCAATCAAAACCGCCACCATTAAGAAAGTCGGTAAGA
AACCATGA
 Primer design