SecReT4
Protein ID: 337267334
T4SS name [ID]Trb [351]
Gene symbol-
Locus tagMesop_2837
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]2943081..2943413 [+]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDF7Y4H5
KEGG IDmop:Mesop_2837
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.8e-22, Aligned region: 9..100
Protein Sequence: 110 a.a.     [Download]
>gi|337267334|ref|YP_004611389.1| Conjugal transfer protein TrbC [Mesorhizobium opportunistum WSM2075]
MIRLLWRCRASLAAASAAIGFDLMVVPFAHASGSSMPWEQPLEKILQSVEGPVSKIMAVIIIIVTGLTLA
FGDSSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|337264537|ref|NC_015675.1|:2943081-2943413 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGATCCGCCTGCTTTGGCGCTGCCGCGCCAGCCTGGCCGCGGCCAGCGCCGCCATTGGCTTCGATCTCA
TGGTCGTCCCGTTCGCCCATGCCTCGGGCTCATCGATGCCATGGGAACAGCCGCTCGAAAAGATCCTGCA
GTCGGTCGAGGGACCGGTCTCCAAGATCATGGCCGTCATCATCATCATCGTCACCGGACTAACGCTGGCC
TTCGGCGACAGTTCGGGCGGTTTCAGGCGGCTCATCCAGATCGTTTTTGGTCTCTCGATCGCCTTTGCGG
CGTCGAGCTTCTTCCTGTCGTTCTTCTCCTTCGGTGGCGGGGCGTTGATCTGA
 Primer design