SecReT4
Protein ID: 337267341
T4SS name [ID]Trb [351]
Gene symbol-
Locus tagMesop_2844
StrainMesorhizobium opportunistum WSM2075
Repliconchromosome [GenBank: NC_015675] [Browse all T4SS(s) in this replicon]
Location [Strand]2948713..2950056 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDF7Y4I2
KEGG IDmop:Mesop_2844
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.2e-53, Aligned region: 37..262
Protein Sequence: 447 a.a.     [Download]
>gi|337267341|ref|YP_004611396.1| P-type conjugative transfer protein TrbL [Mesorhizobium opportunistum WSM2075]
MGNTGVIDQFLATFTRYIDSGFGLLGGEVAFVATTLIVIDVTLAALFWSWGADDDILARLVKKTLFVGVF
AYLISNWNGLAQIVFESFSGLGLKASGTGFSAQDLLHPGKVAQTGLDAGRPLLEAISGLMGYVSFFENFI
QIVCLLFAWSLVLLAFFILAVQLFVTLIEFKLSTLAGFVLIPFGLFGKTAFMAERVLGNVISSGIKVLVL
AVVIGIGSTLFGEFTQGFGGENPTIDQAMAIVLAALSLLGLGIFGPGIANGIVSGGPQLGAGAAVGTGLA
AGGMVLATGGAASLAVSGGSAAFSAGSSIARGGSIAGASGGTAAAASALGGGVGSGGVSQNGSPLRRAAA
RAHESVQSTFSASPRSADTQLGDTATAGTAGGNAERASDPSASRATGPGEVAQNTPDWAKRMQRFQRLSH
GVQTAAHAVRAGDAHGSGISVSLSEGK
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|337264537|ref|NC_015675.1|:2948713-2950056 Mesorhizobium opportunistum WSM2075 chromosome, complete genome
ATGGGCAATACCGGTGTCATCGACCAATTCCTGGCCACTTTCACCCGCTATATCGACAGCGGTTTCGGCC
TGCTTGGCGGCGAGGTCGCCTTCGTCGCCACCACACTGATCGTCATCGACGTGACGCTCGCCGCGCTCTT
CTGGAGCTGGGGCGCTGATGACGACATTCTTGCGCGGCTCGTCAAGAAGACGCTCTTCGTCGGTGTCTTC
GCCTATCTCATATCCAACTGGAACGGTCTCGCTCAAATCGTCTTTGAGAGTTTTTCCGGTCTTGGCCTGA
AGGCGAGTGGAACCGGTTTCTCGGCGCAGGACCTGCTGCACCCCGGCAAGGTGGCGCAAACCGGCCTCGA
TGCGGGACGACCATTGCTTGAGGCGATCTCCGGTTTGATGGGCTACGTCTCCTTCTTTGAAAACTTCATC
CAGATCGTCTGCCTTCTGTTTGCCTGGTCGCTGGTCTTGCTCGCCTTCTTCATCTTGGCGGTGCAGCTCT
TCGTAACGCTGATCGAATTCAAGCTGTCGACGCTGGCCGGCTTTGTGCTGATCCCCTTTGGCCTCTTCGG
CAAGACAGCCTTCATGGCCGAACGCGTGCTTGGCAATGTCATCTCATCGGGCATCAAGGTGCTGGTGCTG
GCCGTCGTCATCGGCATTGGCTCGACGCTGTTCGGCGAGTTCACTCAAGGGTTCGGCGGCGAAAACCCCA
CCATCGACCAGGCTATGGCAATCGTGCTGGCTGCATTGTCACTTCTTGGTCTCGGCATCTTCGGCCCGGG
CATTGCCAACGGCATCGTCTCTGGCGGACCGCAACTCGGTGCGGGTGCCGCCGTCGGTACAGGGCTGGCC
GCAGGCGGCATGGTGCTTGCCACCGGCGGCGCCGCAAGCCTCGCGGTCAGCGGCGGCTCGGCGGCTTTCT
CCGCAGGCAGCTCCATTGCGCGTGGCGGCTCGATTGCAGGCGCCTCGGGCGGCACCGCAGCTGCCGCCTC
CGCCCTGGGCGGCGGCGTTGGGAGCGGCGGTGTTTCGCAGAATGGCTCGCCGCTCAGGCGCGCCGCCGCG
CGTGCCCATGAATCCGTGCAATCGACCTTCTCCGCTAGCCCACGGTCCGCCGACACGCAGCTTGGGGACA
CCGCGACAGCGGGGACGGCCGGGGGCAATGCCGAACGCGCAAGCGACCCTTCCGCCTCCCGCGCGACCGG
CCCGGGCGAAGTAGCACAAAATACACCCGACTGGGCCAAGCGCATGCAGCGGTTCCAGCGCCTGTCGCAC
GGGGTACAGACCGCTGCCCACGCAGTCCGCGCTGGCGACGCCCATGGCAGCGGTATTTCCGTTTCTCTCT
CCGAAGGCAAATGA
 Primer design